{ "uniprot_canonical_ac": "A0A075B666-1", "uniprot_ac": "A0A075B666", "uniprot_id": "A0A075B666_MOUSE", "mass": { "chemical_mass": 12709.0, "monoisotopic_mass": 12709.0 }, "refseq": {}, "gene_names": [ { "name": "Igkv13-85", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A075B666", "id": "A0A075B666" } ], "protein_names": [ { "name": "Immunoglobulin kappa chain variable 13-85", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A075B666/entry#names_and_taxonomy", "id": "A0A075B666" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A075B666", "url": "https://www.uniprot.org/uniprotkb/A0A075B666" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Igkv13-85", "url": "https://www.uniprot.org/uniprotkb/A0A075B666", "locus": { "chromosome": "6", "start_pos": 68907253, "end_pos": 68907718, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000079543", "url": "https://www.ensembl.org/id/ENSMUSG00000079543" } ] } } ], "crossref": [ { "id": "MGI:4439827", "url": "https://alliancegenome.org/gene/MGI:4439827", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "A0A075B666", "url": "https://alphafold.ebi.ac.uk/entry/A0A075B666", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSMUSG00000079543", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000079543", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050150", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050150", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "4439827", "url": "http://www.informatics.jax.org/marker/MGI:4439827", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "HINNWLA", "url": "https://omabrowser.org/oma/group/HINNWLA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A075B666", "url": "https://www.orthodb.org/?gene=A0A075B666", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23267", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23267", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A075B666", "url": "https://www.uniprot.org/uniprotkb/A0A075B666", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A075B666-1", "url": "https://www.uniprot.org/uniprotkb/A0A075B666-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKFPSQLLLFLLFRITGIICDIQMTQSSSYLSVSLGGRVTITCKASDHINNWLAWYQQKPGNAPRLLISGATSLETGVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQQYWSTP", "length": 115, "header": "tr|A0A075B666-1|A0A075B666_MOUSE Isoform 1 of Immunoglobulin kappa chain variable 13-85 OS=Mus musculus OX=10090 GN=Igkv13-85 PE=1 SV=5 CANONICAL=A0A075B666-1" }, "isoforms": [ { "isoform_ac": "A0A075B666-1", "url": "https://www.uniprot.org/uniprotkb/A0A075B666/entry#A0A075B666-1", "sequence": { "sequence": "MKFPSQLLLFLLFRITGIICDIQMTQSSSYLSVSLGGRVTITCKASDHINNWLAWYQQKPGNAPRLLISGATSLETGVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQQYWSTP", "length": 115, "header": "tr|A0A075B666-1|A0A075B666_MOUSE Isoform 1 of Immunoglobulin kappa chain variable 13-85 OS=Mus musculus OX=10090 GN=Igkv13-85 PE=1 SV=5 CANONICAL=A0A075B666-1" }, "locus": { "chromosome": "6", "start_pos": 68907718, "end_pos": 68907255, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000114212.4", "url": "https://www.ensembl.org/id/ENSMUST00000114212.4" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000109850.4", "url": "https://www.ensembl.org/id/ENSMUSP00000109850.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Modernizing reference genome assemblies.", "journal": "PLoS Biol.", "date": "2011", "authors": "Church Deanna M, Schneider Valerie A, Graves Tina, Auger Katherine, Cunningham Fiona, Bouk Nathan, Chen Hsiu-Chuan, Agarwala Richa, McLaren William M, Ritchie Graham R S, Albracht Derek, Kremitzki Milinn, Rock Susan, Kotkiewicz Holland, Kremitzki Colin, Wollam Aye, Trani Lee, Fulton Lucinda, Fulton Robert, Matthews Lucy, Whitehead Siobhan, Chow Will, Torrance James, Dunn Matthew, Harden Glenn, Threadgold Glen, Wood Jonathan, Collins Joanna, Heath Paul, Griffiths Guy, Pelan Sarah, Grafham Darren, Eichler Evan E, Weinstock George, Mardis Elaine R, Wilson Richard K, Howe Kerstin, Flicek Paul, Hubbard Tim", "evidence": [ { "database": "UniProtKB", "id": "A0A075B666", "url": "https://www.uniprot.org/uniprotkb/A0A075B666" } ], "reference": [ { "type": "PubMed", "id": "21750661", "url": "https://glygen.org/publication/PubMed/21750661" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A075B5K0-1", "protein_name": "Immunoglobulin kappa variable 14-126", "gene_name": "Igkv14-126", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDMRAPAQFFGILLLWFPGIRCDIKMTQSPSSMYASLGERVTITCKASQDIKSYLSWYQQKPWKSPKTLIYYATSLADGVPSRFSGSGSGQDYSLTISSLESDDTATYYCLQHGESP", "length": 117 }, "evidence": [ { "id": "HGNC:5735", "url": "https://alliancegenome.org/gene/HGNC:5735#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A075B6S5-1", "protein_name": "Immunoglobulin kappa variable 1-27", "gene_name": "IGKV1-27", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDMRVPAQLLGLLLLWLPDTRCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSAP", "length": 117 }, "evidence": [ { "id": "HGNC:5735", "url": "https://alliancegenome.org/gene/HGNC:5735#orthology", "database": "AGR" }, { "id": "MGI:4439827", "url": "https://alliancegenome.org/gene/MGI:4439827#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1I5-1", "protein_name": "Immunoglobulin kappa chain variable 4-70", "gene_name": "Igkv4-70", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDFQVQIFSFLLISASVILSRGQIVLTQSPAIMSASPGEKVTMTCSASSSISYMHWYQQKPGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCHQRSSYP", "length": 116 }, "evidence": [ { "id": "HGNC:5735", "url": "https://alliancegenome.org/gene/HGNC:5735#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A0B4J1I6-1", "protein_name": "Immunoglobulin kappa variable 4-69", "gene_name": "Igkv4-69", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDFQVQIFSFLLISASVIMSRGQILLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKPGSSPKPWIYDTSNLASGFPARFSGSGSGTSYSLIISSMEAEDAATYYCHQRSSYP", "length": 116 }, "evidence": [ { "id": "HGNC:5735", "url": "https://alliancegenome.org/gene/HGNC:5735#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A0G2JEI7-1", "protein_name": "Immunoglobulin kappa chain variable 12-38", "gene_name": "Igkv12-38", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSVPTQLLGLLLLWLTDAGCDIQMTQSPASLAASVGETVTITCRASENIYYSLAWYQQKQGKSPQLLIYNANSLEDGVPSRFSGSGSGTQYSMKINSMQPEDTATYFCKQAYDVP", "length": 115 }, "evidence": [ { "id": "HGNC:5735", "url": "https://alliancegenome.org/gene/HGNC:5735#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A0G2JGF9-1", "protein_name": "Immunoglobulin kappa variable 12-98", "gene_name": "Igkv12-98", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNMLTQLLGLLLLWFAGGKCDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTP", "length": 115 }, "evidence": [ { "id": "HGNC:5735", "url": "https://alliancegenome.org/gene/HGNC:5735#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A0G2JGW8-1", "protein_name": "Immunoglobulin kappa chain variable 12-89", "gene_name": "Igkv12-89", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGVPTQLLLLWLTVVRCDIQMTQSPASLSASVGETVTITCGASENIYGALNWYQRKQGKSPQLLIYGATNLADGMSSRFSGSGSGRQYSLKISSLHPDDVATYYCQNVLSTP", "length": 112 }, "evidence": [ { "id": "HGNC:5735", "url": "https://alliancegenome.org/gene/HGNC:5735#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A140T8M2-1", "protein_name": "Immunoglobulin kappa variable 12-44", "gene_name": "Igkv12-44", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSVPTQVLGLLLLWLTGARCDIQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYGTP", "length": 115 }, "evidence": [ { "id": "HGNC:5735", "url": "https://alliancegenome.org/gene/HGNC:5735#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A140T8N3-1", "protein_name": "Immunoglobulin kappa chain variable 13-84", "gene_name": "Igkv13-84", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKFPSQLLLLLLFGIPGMICDIQMTQSSSSFSVSLGDRVTITCKASEDIYNRLAWYQQKPGNAPRLLISGATSLETGVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQQYWSTP", "length": 115 }, "evidence": [ { "id": "HGNC:5735", "url": "https://alliancegenome.org/gene/HGNC:5735#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A140T8P6-1", "protein_name": "Immunoglobulin kappa variable 12-46", "gene_name": "Igkv12-46", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSVPTQVLGLLLLWLTDARCDIQMTQSPASLSVSVGETVTITCRASENIYSNLAWYQQKQGKSPQLLVYAATNLADGVPSRFSGSGSGTQYSLKINSLQSEDFGSYYCQHFWGTP", "length": 115 }, "evidence": [ { "id": "HGNC:5735", "url": "https://alliancegenome.org/gene/HGNC:5735#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A140T8P9-1", "protein_name": "Immunoglobulin kappa variable 14-111", "gene_name": "Igkv14-111", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDMRTPAQFLGILLLWFPGIKCDIKMTQSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFP", "length": 117 }, "evidence": [ { "id": "HGNC:5735", "url": "https://alliancegenome.org/gene/HGNC:5735#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A8I6GD94-1", "protein_name": "Immunoglobulin kappa variable like, pseudogene 2", "gene_name": "Igkvl-ps2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTQSPPSLSASLGETISIECLASEGIYSNLAWYQQKPGKSPQLLIYGASSLQDGVPSRFSGSGSGTQFSLKISSMQPEDEADYFCQQSYKFPPTVIQAMT", "length": 100 }, "evidence": [ { "id": "HGNC:5735", "url": "https://alliancegenome.org/gene/HGNC:5735#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "D3ZMS7-1", "protein_name": "Ig-like domain-containing protein", "gene_name": "ENSRNOG00000070810", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAPVQLLGLLLLCLPAMRCDIQMTQSPSLLSASVGDRVTLNCKASQNIYKNLEWYQQKHGEAPKLLIYYTNNLQTGISSRFSGSGSGTDYTLTISSLQPEDVATYYCYQYNSGPHG", "length": 116 }, "evidence": [ { "id": "A0A075B666", "url": "https://omabrowser.org/oma/group/A0A075B666/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P01635-1", "protein_name": "Immunoglobulin kappa chain variable 12-41", "gene_name": "Igkv12-41", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSVLTQVLALLLLWLTGARCDIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTP", "length": 115 }, "evidence": [ { "id": "HGNC:5735", "url": "https://alliancegenome.org/gene/HGNC:5735#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A075B666-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 115, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A075B666-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A075B666" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.agr", "label": "AGR Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }