{ "uniprot_canonical_ac": "A0A075B623-1", "uniprot_ac": "A0A075B623", "uniprot_id": "A0A075B623_MOUSE", "mass": { "chemical_mass": 10342.0, "monoisotopic_mass": 10342.0 }, "refseq": {}, "gene_names": [ { "name": "Trav6n-6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A075B623", "id": "A0A075B623" } ], "protein_names": [ { "name": "T cell receptor alpha variable 6N-6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A075B623/entry#names_and_taxonomy", "id": "A0A075B623" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A0A075B623", "url": "https://www.uniprot.org/uniprotkb/A0A075B623" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "gene": [ { "name": "Trav6n-6", "url": "https://www.uniprot.org/uniprotkb/A0A075B623", "locus": { "chromosome": "14", "start_pos": 53370594, "end_pos": 53370136, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000076802", "url": "https://www.ensembl.org/id/ENSMUSG00000076802" } ] } } ], "crossref": [ { "id": "MGI:3642618", "url": "https://alliancegenome.org/gene/MGI:3642618", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "A0A075B623", "url": "https://alphafold.ebi.ac.uk/entry/A0A075B623", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSMUSG00000076802", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000076802", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051287", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051287", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "3642618", "url": "http://www.informatics.jax.org/marker/MGI:3642618", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "YMLKEYA", "url": "https://omabrowser.org/oma/group/YMLKEYA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR19367", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19367", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19367:SF44", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19367:SF44", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A075B623", "url": "https://www.uniprot.org/uniprotkb/A0A075B623", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A075B623-1", "url": "https://www.uniprot.org/uniprotkb/A0A075B623-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A075B6B2", "url": "https://www.uniprot.org/uniprotkb/A0A075B6B2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A075B6B2-1", "url": "https://www.uniprot.org/uniprotkb/A0A075B6B2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "GDSVTQTEGQVTVSESKSLIINCTYSATSIGYPNLFWYVRYPGEGLQLLLKVITAGQKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALS", "length": 95, "header": "tr|A0A075B623-1|A0A075B623_MOUSE Isoform 1 of T cell receptor alpha variable 6N-6 OS=Mus musculus OX=10090 GN=Trav6n-6 PE=4 SV=1 CANONICAL=A0A075B623-1" }, "isoforms": [ { "isoform_ac": "A0A075B623-1", "url": "https://www.uniprot.org/uniprotkb/A0A075B623/entry#A0A075B623-1", "sequence": { "sequence": "GDSVTQTEGQVTVSESKSLIINCTYSATSIGYPNLFWYVRYPGEGLQLLLKVITAGQKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALS", "length": 95, "header": "tr|A0A075B623-1|A0A075B623_MOUSE Isoform 1 of T cell receptor alpha variable 6N-6 OS=Mus musculus OX=10090 GN=Trav6n-6 PE=4 SV=1 CANONICAL=A0A075B623-1" }, "locus": { "chromosome": "14", "start_pos": 53370592, "end_pos": 53370308, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000103613.3", "url": "https://www.ensembl.org/id/ENSMUST00000103613.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000100390.3", "url": "https://www.ensembl.org/id/ENSMUSP00000100390.3" } ] } }, { "isoform_ac": "A0A075B6B2-1", "url": "https://www.uniprot.org/uniprotkb/A0A075B623/entry#A0A075B6B2-1", "sequence": { "sequence": "MDSSPGFVAVILLILGRTHGDSVTQTEGQVTVSESKSLIINCTYSATSIGYPNLFWYVRYPGEGLQLLLKVITAGQKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALS", "length": 114, "header": "tr|A0A075B6B2-1|A0A075B623_MOUSE Computationally mapped isoform of T cell receptor alpha variable 6N-6 OS=Mus musculus OX=10090 GN=Trav6n-6 PE=4 SV=1 CANONICAL=A0A075B623-1" }, "locus": { "chromosome": "14", "start_pos": 53370592, "end_pos": 53370157, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000181793.3", "url": "https://www.ensembl.org/id/ENSMUST00000181793.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000137708.3", "url": "https://www.ensembl.org/id/ENSMUSP00000137708.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Modernizing reference genome assemblies.", "journal": "PLoS Biol.", "date": "2011", "authors": "Church Deanna M, Schneider Valerie A, Graves Tina, Auger Katherine, Cunningham Fiona, Bouk Nathan, Chen Hsiu-Chuan, Agarwala Richa, McLaren William M, Ritchie Graham R S, Albracht Derek, Kremitzki Milinn, Rock Susan, Kotkiewicz Holland, Kremitzki Colin, Wollam Aye, Trani Lee, Fulton Lucinda, Fulton Robert, Matthews Lucy, Whitehead Siobhan, Chow Will, Torrance James, Dunn Matthew, Harden Glenn, Threadgold Glen, Wood Jonathan, Collins Joanna, Heath Paul, Griffiths Guy, Pelan Sarah, Grafham Darren, Eichler Evan E, Weinstock George, Mardis Elaine R, Wilson Richard K, Howe Kerstin, Flicek Paul, Hubbard Tim", "evidence": [ { "database": "UniProtKB", "id": "A0A075B6B2", "url": "https://www.uniprot.org/uniprotkb/A0A075B6B2" } ], "reference": [ { "type": "PubMed", "id": "21750661", "url": "https://glygen.org/publication/PubMed/21750661" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "A0A075B5Z8-1", "protein_name": "T cell receptor alpha variable 6-1", "gene_name": "Trav6-1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNYSPALVTVMLFVFGRTHGDSVTQMQGQVTLSEDDFLFINCTYSTTWYPTLFWYVQYPGEGPQLLLKVTTANNKGISRGFEATYDKGTTSFHLQKASVQESDSAVYYCVLG", "length": 112 }, "evidence": [ { "id": "HGNC:12154", "url": "https://alliancegenome.org/gene/HGNC:12154#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A075B603-1", "protein_name": "T cell receptor alpha variable 6D-6", "gene_name": "Trav6-6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDSSPGFVAVILLILGRTHGDSVTQTEGPVTVSESESLIINCTYSATSIAYPNLFWYVRYPGEGLQLLLKVITAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALG", "length": 114 }, "evidence": [ { "id": "RGD:2323744", "url": "https://alliancegenome.org/gene/RGD:2323744#orthology", "database": "AGR" }, { "id": "HGNC:12154", "url": "https://alliancegenome.org/gene/HGNC:12154#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A075B639-1", "protein_name": "T cell receptor alpha variable 6-7-DV9", "gene_name": "Trav6-7-dv9", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLRIMNTVEMGLKMNSSPGFMTVMLLIFTRAHGDSVTQTEGQVALSEEDFLTIHCNYSASGYPTLFWYVQYPGEGPQLLFRASRDKEKGSSRGFEATYDKGTTSFHLRKASVQESDSAVYYCALS", "length": 125 }, "evidence": [ { "id": "HGNC:12154", "url": "https://alliancegenome.org/gene/HGNC:12154#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A075B6A6-1", "protein_name": "T cell receptor alpha variable 6N-7", "gene_name": "Trav6n-7", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGLKMNSSPGFMTVMLLIFTRAHGDSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYDKGTTSFHLRKASVQESDSAVYYCALG", "length": 116 }, "evidence": [ { "id": "HGNC:12154", "url": "https://alliancegenome.org/gene/HGNC:12154#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A075B6B0-1", "protein_name": "T cell receptor alpha variable 6D-7", "gene_name": "Trav6d-7", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNSSPGFMTVMLLIFTRAHGDSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSRGFEATYDKGTTSFHLRKASVQESDSAVYYCALG", "length": 112 }, "evidence": [ { "id": "HGNC:12154", "url": "https://alliancegenome.org/gene/HGNC:12154#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A075B6B4-1", "protein_name": "T cell receptor alpha variable 6-4", "gene_name": "Trav6-4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNTSPVLVTVMLLFMLGMRKTHGDSVTQKQGQVTLSEDDFLFINCTYSTTTYPTLLWYVQYLGQGPQLLLKVTTANNKGISRGFEATYDKGTTSFHLQKASVQESDSAVYFCALV", "length": 115 }, "evidence": [ { "id": "HGNC:12154", "url": "https://alliancegenome.org/gene/HGNC:12154#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A075B6D3-1", "protein_name": "T cell receptor alpha variable 6D-3", "gene_name": "Trav6d-3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "IFFLSGRTHGDSVIQMQGQVTLSENDFLFINCTYSTTGYPTLFWYVQYSGEGPQLLLQVTTANNKGSSRGFEATYDKGTTSFHLQKTSVQEIDSAVYYCAMS", "length": 102 }, "evidence": [ { "id": "HGNC:12154", "url": "https://alliancegenome.org/gene/HGNC:12154#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "A0A087WT02-1", "protein_name": "T cell receptor alpha variable 9-2", "gene_name": "TRAV9-2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNYSPGLVSLILLLLGRTRGDSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS", "length": 112 }, "evidence": [ { "id": "MGI:3642618", "url": "https://alliancegenome.org/gene/MGI:3642618#orthology", "database": "AGR" }, { "id": "RGD:2323744", "url": "https://alliancegenome.org/gene/RGD:2323744#orthology", "database": "AGR" }, { "id": "HGNC:12154", "url": "https://alliancegenome.org/gene/HGNC:12154#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "A0A0G2K7X8-1", "protein_name": "MCG140239-like", "gene_name": "LOC100362949", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDSSPGFVAVILLLLGRTHGDSVTQTEGQVTISENGFLRINCTYSATSIVYPNLFWYVQYPGEGLQLLLKVFTAGQKGSSRGFEATYNKETTSFHLQKASVQESDSAVYYCALGDTVAETTGGAEHKPRG", "length": 130 }, "evidence": [ { "id": "MGI:3642618", "url": "https://alliancegenome.org/gene/MGI:3642618#orthology", "database": "AGR" }, { "id": "RGD:2323744", "url": "https://alliancegenome.org/gene/RGD:2323744#orthology", "database": "AGR" }, { "id": "HGNC:12154", "url": "https://alliancegenome.org/gene/HGNC:12154#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "A0A8I6AWV9-1", "protein_name": "T cell receptor alpha variable 9-2 like 1", "gene_name": "Trav9-2l1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MNIVEVALKMDSSQGLLAVMLLILTRAHGDSVTQTQGQVVLSEKDILTIHCNYSAAGYPALFWYVQYPGEGLQLLFRASKANEKGSSRGFEATYDKETTSFHLQKASVQASDSAVYYCALNDTVAETTEGAEHKL", "length": 135 }, "evidence": [ { "id": "HGNC:12154", "url": "https://alliancegenome.org/gene/HGNC:12154#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "M0R7S3-1", "protein_name": "T cell receptor alpha variable 6-1", "gene_name": "Trav6-1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDSSPGFVAVILLLLGRTRGDSVTQTEGQVTISENGFLRINCTYSATSIGYPTLFWYFQYPGESLQLLLKVITAGEKGSSKGFEATYNKETTSFHLQKASVQESDSAMYYCALGDTVAETTGGAEHKPRGNRWSDC", "length": 136 }, "evidence": [ { "id": "HGNC:12154", "url": "https://alliancegenome.org/gene/HGNC:12154#orthology", "database": "AGR" }, { "id": "A0A075B623", "url": "https://omabrowser.org/oma/group/A0A075B623/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q5R1E6-1", "protein_name": "TRAV6-3", "gene_name": "Trav6-3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNNSPALVTVMLFILGRTHGDSVIQMQGQVTLSENDFLFINCTYSTTGYPTLFWYVQYSGEGPQLLLQVTTANNKGSSRGFEATYDKGTTSFHLQKTSVQEIDSAVYYCAMR", "length": 112 }, "evidence": [ { "id": "HGNC:12154", "url": "https://alliancegenome.org/gene/HGNC:12154#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q5R1I0-1", "protein_name": "TRAV6D-4", "gene_name": "Trav6d-4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNTSPVLVTAMLLFMLGMRKTHGDSVTQKQGQVTLSEDDFLFINCTYSTTTYPTLFWYVQYPGQGPQLLLKVTTANNKGISRGFEATYDKGTTSFHLQKASVQESDSAVYFCALV", "length": 115 }, "evidence": [ { "id": "HGNC:12154", "url": "https://alliancegenome.org/gene/HGNC:12154#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q5R1I4-1", "protein_name": "T cell receptor alpha variable 6-2", "gene_name": "Trav6-2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNTSPALVTVMLLFMLERTHGNSVTQMQGQVTLSEEEFLFINCTYSTTGYPTLFWYVQYPGEGPQLLLKVTTANNKGSSRGFEATYDKGTTSFHLQKASVQESDSAVYYCVLG", "length": 113 }, "evidence": [ { "id": "HGNC:12154", "url": "https://alliancegenome.org/gene/HGNC:12154#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "T cell receptor complex", "id": "GO:0042101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042101", "evidence": [ { "database": "UniProtKB", "id": "A0A075B623", "url": "https://www.uniprot.org/uniprotkb/A0A075B623" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "A0A075B623", "url": "https://www.uniprot.org/uniprotkb/A0A075B623" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 22, "end_pos": 24, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-A0A075B623-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 95, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-A0A075B623-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/A0A075B623" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.agr", "label": "AGR Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 22, "end_pos": 24 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }