{ "bcoid": "GLY_000654", "title": "Fruitfly Protein Site Annotation", "description": "The Fruitfly Protein Site Annotation (UniProtKB) dataset contains fruitfly [taxid:7227] site annotations ...", "filename": "fruitfly_protein_site_annotation_uniprotkb.csv", "filetype": "csv", "categories": { "species": [ "Drosophila melanogaster" ], "molecule": [ "Protein" ], "tags": [ "site annotation" ], "file_type": [ "csv" ], "status": [ "Reviewed" ], "scope": [ "internal" ] }, "minitable": { "content": [ [ "P40796-1...", "La..." ], [ "P40796-1...", "La..." ] ], "headers": [ "uniprotkb_ca...", "gene_symbol..." ], "colwidth": [ "40%", "20%" ] }, "sampledata": { "type": "table", "data": [ [ { "type": "string", "label": "uniprotkb_canonical_ac" }, { "type": "string", "label": "gene_symbol" }, { "type": "string", "label": "ann_type" }, { "type": "string", "label": "start_pos" }, { "type": "string", "label": "end_pos" }, { "type": "string", "label": "annotation" }, { "type": "string", "label": "ecoid" }, { "type": "string", "label": "ref_aa" }, { "type": "string", "label": "alt_aa" }, { "type": "string", "label": "xref_key" }, { "type": "string", "label": "xref_id" } ], [ "P40796-1", "La", "Modified_Residue_Annotation", "9", "9", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "P40796" ], [ "P40796-1", "La", "Modified_Residue_Annotation", "9", "9", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "17372656" ], [ "P40796-1", "La", "Modified_Residue_Annotation", "7", "7", "Phosphothreonine", "ECO_0000269", "T", "", "protein_xref_uniprotkb", "P40796" ], [ "P40796-1", "La", "Modified_Residue_Annotation", "7", "7", "Phosphothreonine", "ECO_0000269", "T", "", "protein_xref_pubmed", "17372656" ], [ "P40797-1", "pnut", "Modified_Residue_Annotation", "517", "517", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "P40797" ], [ "P40797-1", "pnut", "Modified_Residue_Annotation", "517", "517", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "18327897" ], [ "P40797-1", "pnut", "Modified_Residue_Annotation", "6", "6", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "P40797" ], [ "P40797-1", "pnut", "Modified_Residue_Annotation", "6", "6", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "17372656" ], [ "P40797-1", "pnut", "Modified_Residue_Annotation", "13", "13", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "P40797" ], [ "P40797-1", "pnut", "Modified_Residue_Annotation", "13", "13", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "17372656" ], [ "P40795-1", "fog", "Glycosylation_Annotation", "459", "459", "N-linked (GlcNAc...) asparagine", "", "N", "", "protein_xref_uniprotkb", "P40795" ], [ "P40795-1", "fog", "Glycosylation_Annotation", "252", "252", "N-linked (GlcNAc...) asparagine", "", "N", "", "protein_xref_uniprotkb", "P40795" ], [ "P40795-1", "fog", "Glycosylation_Annotation", "678", "678", "N-linked (GlcNAc...) asparagine", "", "N", "", "protein_xref_uniprotkb", "P40795" ], [ "P40795-1", "fog", "Glycosylation_Annotation", "193", "193", "N-linked (GlcNAc...) asparagine", "", "N", "", "protein_xref_uniprotkb", "P40795" ], [ "P40795-1", "fog", "Glycosylation_Annotation", "289", "289", "N-linked (GlcNAc...) asparagine", "", "N", "", "protein_xref_uniprotkb", "P40795" ], [ "P40795-1", "fog", "Glycosylation_Annotation", "51", "51", "N-linked (GlcNAc...) asparagine", "", "N", "", "protein_xref_uniprotkb", "P40795" ], [ "P40795-1", "fog", "Glycosylation_Annotation", "590", "590", "N-linked (GlcNAc...) asparagine", "", "N", "", "protein_xref_uniprotkb", "P40795" ], [ "P40795-1", "fog", "Glycosylation_Annotation", "639", "639", "N-linked (GlcNAc...) asparagine", "", "N", "", "protein_xref_uniprotkb", "P40795" ], [ "P40792-1", "Rac1", "Modified_Residue_Annotation", "189", "189", "Cysteine methyl ester", "", "C", "", "protein_xref_uniprotkb", "P40792" ], [ "P40793-1", "Cdc42", "Modified_Residue_Annotation", "188", "188", "Cysteine methyl ester", "", "C", "", "protein_xref_uniprotkb", "P40793" ], [ "P40793-1", "Cdc42", "Mutagenesis_Annotation", "12", "12", "Enhances interaction with mbt. Coexpression with mbt slightly reduced the substrate phosphorylation ability of mbt.", "ECO_0000269", "G", "V", "protein_xref_uniprotkb", "P40793" ], [ "P40793-1", "Cdc42", "Mutagenesis_Annotation", "12", "12", "Enhances interaction with mbt. Coexpression with mbt slightly reduced the substrate phosphorylation ability of mbt.", "ECO_0000269", "G", "V", "protein_xref_pubmed", "12490550" ], [ "P40791-1", "Mef2", "Modified_Residue_Annotation", "95", "95", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "P40791" ], [ "P40791-1", "Mef2", "Modified_Residue_Annotation", "95", "95", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "18327897" ], [ "P40791-1", "Mef2", "Modified_Residue_Annotation", "98", "98", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "P40791" ], [ "P40791-1", "Mef2", "Modified_Residue_Annotation", "98", "98", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "18327897" ], [ "P40791-1", "Mef2", "Nucleotide_Binding_Annotation", "58", "86", "Mef2-type", "", "ASTDMDRVLLKYTEYNEPHESLTNKNIIE", "", "protein_xref_uniprotkb", "P40791" ], [ "P40798-1", "stc", "Modified_Residue_Annotation", "343", "343", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "P40798" ], [ "P40798-1", "stc", "Modified_Residue_Annotation", "343", "343", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "18327897" ], [ "P40798-1", "stc", "Modified_Residue_Annotation", "335", "335", "Phosphothreonine", "ECO_0000269", "T", "", "protein_xref_uniprotkb", "P40798" ], [ "P40798-1", "stc", "Modified_Residue_Annotation", "335", "335", "Phosphothreonine", "ECO_0000269", "T", "", "protein_xref_pubmed", "18327897" ], [ "P40798-1", "stc", "Modified_Residue_Annotation", "339", "339", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "P40798" ], [ "P40798-1", "stc", "Modified_Residue_Annotation", "339", "339", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "18327897" ], [ "P40798-1", "stc", "Modified_Residue_Annotation", "336", "336", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "P40798" ], [ "P40798-1", "stc", "Modified_Residue_Annotation", "336", "336", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "18327897" ], [ "P40798-1", "stc", "Modified_Residue_Annotation", "354", "354", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "P40798" ], [ "P40798-1", "stc", "Modified_Residue_Annotation", "354", "354", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "18327897" ], [ "P40421-1", "rdgC", "Active_Site_Annotation", "220", "220", "Proton donor", "", "H", "", "protein_xref_uniprotkb", "P40421" ], [ "P40423-1", "sqh", "Modified_Residue_Annotation", "21", "21", "Phosphothreonine", "ECO_0000269", "T", "", "protein_xref_uniprotkb", "P40423" ], [ "P40423-1", "sqh", "Modified_Residue_Annotation", "21", "21", "Phosphothreonine", "ECO_0000269", "T", "", "protein_xref_pubmed", "18327897" ], [ "P40423-1", "sqh", "Modified_Residue_Annotation", "21", "21", "Phosphothreonine", "ECO_0000269", "T", "", "protein_xref_pubmed", "17372656" ], [ "P40423-1", "sqh", "Modified_Residue_Annotation", "22", "22", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "P40423" ], [ "P40423-1", "sqh", "Modified_Residue_Annotation", "22", "22", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "18327897" ], [ "P40423-1", "sqh", "Modified_Residue_Annotation", "22", "22", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "17372656" ], [ "P40427-1", "exd", "Nucleotide_Binding_Annotation", "238", "300", "Homeobox; TALE-type", "ECO_0000255", "ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI", "", "protein_xref_uniprotkb", "P40427" ], [ "P40427-1", "exd", "Nucleotide_Binding_Annotation", "238", "300", "Homeobox; TALE-type", "ECO_0000255", "ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI", "", "protein_xref_pubmed", "PRU00108" ], [ "Q9VE86-1", "WRNexo", "Modified_Residue_Annotation", "109", "109", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "Q9VE86" ], [ "Q9VE86-1", "WRNexo", "Modified_Residue_Annotation", "109", "109", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "18327897" ], [ "Q9VE86-1", "WRNexo", "Modified_Residue_Annotation", "103", "103", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "Q9VE86" ], [ "Q9VE86-1", "WRNexo", "Modified_Residue_Annotation", "103", "103", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "18327897" ], [ "Q9VE86-1", "WRNexo", "Modified_Residue_Annotation", "111", "111", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "Q9VE86" ], [ "Q9VE86-1", "WRNexo", "Modified_Residue_Annotation", "111", "111", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "18327897" ], [ "Q9VE86-1", "WRNexo", "Mutagenesis_Annotation", "164", "164", "Completely lacks exonuclease activity, when associated with A-162.", "ECO_0000269", "E", "A", "protein_xref_uniprotkb", "Q9VE86" ], [ "Q9VE86-1", "WRNexo", "Mutagenesis_Annotation", "164", "164", "Completely lacks exonuclease activity, when associated with A-162.", "ECO_0000269", "E", "A", "protein_xref_pubmed", "18956248" ], [ "Q9VE86-1", "WRNexo", "Mutagenesis_Annotation", "162", "162", "Completely lacks exonuclease activity, when associated with A-164.", "ECO_0000269", "D", "A", "protein_xref_uniprotkb", "Q9VE86" ], [ "Q9VE86-1", "WRNexo", "Mutagenesis_Annotation", "162", "162", "Completely lacks exonuclease activity, when associated with A-164.", "ECO_0000269", "D", "A", "protein_xref_pubmed", "18956248" ], [ "Q9VE86-1", "WRNexo", "Mutagenesis_Annotation", "229", "229", "20-fold increase in levels of mitotic recombination, very limited 3'-5' exonuclease activity.", "ECO_0000269", "D", "V", "protein_xref_uniprotkb", "Q9VE86" ], [ "Q9VE86-1", "WRNexo", "Mutagenesis_Annotation", "229", "229", "20-fold increase in levels of mitotic recombination, very limited 3'-5' exonuclease activity.", "ECO_0000269", "D", "V", "protein_xref_pubmed", "18956248" ], [ "P05389-1", "RpLP2", "Modified_Residue_Annotation", "102", "102", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "P05389" ], [ "P05389-1", "RpLP2", "Modified_Residue_Annotation", "102", "102", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "18327897" ], [ "P05389-1", "RpLP2", "Modified_Residue_Annotation", "100", "100", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_uniprotkb", "P05389" ], [ "P05389-1", "RpLP2", "Modified_Residue_Annotation", "100", "100", "Phosphoserine", "ECO_0000269", "S", "", "protein_xref_pubmed", "18327897" ], [ "Q9VK71-1", "pdm2", "Nucleotide_Binding_Annotation", "786", "845", "Homeobox", "ECO_0000256", "RRKKRTSIETTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEKRIN", "", "protein_xref_uniprotkb", "X2J9L4" ], [ "Q9VK71-1", "pdm2", "Nucleotide_Binding_Annotation", "786", "845", "Homeobox", "ECO_0000256", "RRKKRTSIETTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEKRIN", "", "protein_xref_pubmed", "PRU00108" ], [ "P04388-1", "Ras64B", "Modified_Residue_Annotation", "189", "189", "Cysteine methyl ester", "", "C", "", "protein_xref_uniprotkb", "P04388" ], [ "P04388-1", "Ras64B", "Mutagenesis_Annotation", "120", "120", "Reduces palmitoylation. Loss of palmitoylation; when associated with A-120 and A-147.", "ECO_0000269", "C", "A", "protein_xref_uniprotkb", "P04388" ], [ "P04388-1", "Ras64B", "Mutagenesis_Annotation", "120", "120", "Reduces palmitoylation. Loss of palmitoylation; when associated with A-120 and A-147.", "ECO_0000269", "C", "A", "protein_xref_pubmed", "30735487" ], [ "P04388-1", "Ras64B", "Mutagenesis_Annotation", "147", "147", "Reduces palmitoylation. Loss of palmitoylation; when associated with A-120 and A-147.", "ECO_0000269", "C", "A", "protein_xref_uniprotkb", "P04388" ], [ "P04388-1", "Ras64B", "Mutagenesis_Annotation", "147", "147", "Reduces palmitoylation. Loss of palmitoylation; when associated with A-120 and A-147.", "ECO_0000269", "C", "A", "protein_xref_pubmed", "30735487" ], [ "P04388-1", "Ras64B", "Mutagenesis_Annotation", "14", "14", "Causes developmental abnormalities.", "ECO_0000269", "G", "V", "protein_xref_uniprotkb", "P04388" ], [ "P04388-1", "Ras64B", "Mutagenesis_Annotation", "14", "14", "Causes developmental abnormalities.", "ECO_0000269", "G", "V", "protein_xref_pubmed", "2838380" ], [ "P04388-1", "Ras64B", "Mutagenesis_Annotation", "46", "46", "Reduces protein stability and palmitoylation. Loss of palmitoylation; when associated with A-120 and A-147.", "ECO_0000269", "C", "A", "protein_xref_uniprotkb", "P04388" ], [ "P04388-1", "Ras64B", "Mutagenesis_Annotation", "46", "46", "Reduces protein stability and palmitoylation. Loss of palmitoylation; when associated with A-120 and A-147.", "ECO_0000269", "C", "A", "protein_xref_pubmed", "30735487" ], [ "Q9VLI6-1", "CatB", "Binding_Site_Annotation", "356", "356", "axial binding residue", "ECO_0000256", "Y", "", "protein_xref_uniprotkb", "Q9VLI6" ], [ "Q9VLI6-1", "CatB", "Binding_Site_Annotation", "356", "356", "axial binding residue", "ECO_0000256", "Y", "", "protein_xref_pubmed", "PIRSR038928-2" ], [ "A0A0B4KFC4-1", "rib", "Nucleotide_Binding_Annotation", "390", "410", "H-T-H motif", "ECO_0000256", "ALQASRKYGLPSRTLYDKVRK", "", "protein_xref_uniprotkb", "A0A0B4KFC4" ], [ "A0A0B4KFC4-1", "rib", "Nucleotide_Binding_Annotation", "390", "410", "H-T-H motif", "ECO_0000256", "ALQASRKYGLPSRTLYDKVRK", "", "protein_xref_pubmed", "PRU00320" ], [ "P17336-1", "Cat", "Binding_Site_Annotation", "356", "356", "axial binding residue", "", "Y", "", "protein_xref_uniprotkb", "P17336" ], [ "P16241-1", "vvl", "Nucleotide_Binding_Annotation", "304", "363", "Homeobox", "ECO_0000256", "KRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMT", "", "protein_xref_uniprotkb", "A0A0S0WGV5" ], [ "P16241-1", "vvl", "Nucleotide_Binding_Annotation", "304", "363", "Homeobox", "ECO_0000256", "KRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMT", "", "protein_xref_pubmed", "PRU00108" ], [ "Q9VWS0-1", "Ing3", "Site_Annotation", "645", "645", "Histone H3K4me3 binding", "ECO_0000256", "D", "", "protein_xref_uniprotkb", "Q9VWS0" ], [ "Q9VWS0-1", "Ing3", "Site_Annotation", "645", "645", "Histone H3K4me3 binding", "ECO_0000256", "D", "", "protein_xref_pubmed", "PIRSR628651-50" ], [ "Q9VWS0-1", "Ing3", "Site_Annotation", "653", "653", "Histone H3K4me3 binding", "ECO_0000256", "W", "", "protein_xref_uniprotkb", "Q9VWS0" ], [ "Q9VWS0-1", "Ing3", "Site_Annotation", "653", "653", "Histone H3K4me3 binding", "ECO_0000256", "W", "", "protein_xref_pubmed", "PIRSR628651-50" ] ] }, "readme": "Name\n - Fruitfly Protein Site Annotation\n\nVersion\n - v-2.1.1\n\nCreated on\n - 2022-08-31T11:08:19.037259\n\nModified on\n - 2022-09-26T09:08:12.471396\n\nCreated by\n - Jeet Vora [jeetvora@gwu.edu], Robel Kahsay [rykahsay@gwu.edu], Karina Martinez [karinamartinez@gwu.edu], Jingyue Wu [jingyue.wu@email.gwu.edu]\n\nAuthors\n - Maria Martin [martin@ebi.ac.uk], Preethi Vasudev [pvasudev@ebi.ac.uk]\n\nChecksum\n - \n\nUsability Domain\n - The Fruitfly Protein Site Annotation (UniProtKB) dataset contains fruitfly [taxid:7227] site annotations for UniProtKB canonical accessions. The dataset contains information about UniProtKB annotations with their amino acid range. If you use this dataset please give proper attribution to UniProtKB and GlyGen\n\nDescription Domain\n Keywords\n - site annotation\n - amino acid range\n - UniProtKB\n\n Pipeline Steps\n - Step-1: The script extracts the site annotation triples from the triplestore for the UniProtKB canonical sequnces asnd extracts as a dataset in a csv format\n\nExecution Domain\n Scripts - https://github.com/glygener/glygen-backend-integration/blob/master/dataset-maker/make-protein-dataset.py\n\n\n Software Prerequisites\n Name: Python\n Version: 2.7.5\n URI: https://www.python.org/download/releases/2.7.5/\n\nI/O Domain\n Input Subdomain\n Name: fruitfly_protein_masterlist.csv\n URI: https:/data.glygen.org/ln2releases/data/v-2.1.1/reviewed/fruitfly_protein_masterlist.csv\n Name: uniprot-proteome-drosophila-melanogaster.nt\n URI: /data/shared/glyds/downloads/ebi/2023_02/uniprot-proteome-drosophila-melanogaster.nt\n Output Subdomain\n Name: fruitfly_protein_site_annotation_uniprotkb.csv\n URI: https:/data.glygen.org/ln2releases/data/v-2.1.1/reviewed/fruitfly_protein_site_annotation_uniprotkb.csv\n Name: fruitfly_protein_site_annotation_uniprotkb.stat.csv\n URI: https:/data.glygen.org/ln2releases/data/v-2.1.1/reviewed/fruitfly_protein_site_annotation_uniprotkb.stat.csv\n\nFields\n Name: \"uniprotkb_canonical_ac\"\n Description: \"\"\n Unique Values: \"2444\"\n Name: \"gene_symbol\"\n Description: \"\"Official gene name/symbol assigned to the gene. Human gene names/symbols are approved by the HUGO Gene Nomenclature Committee (HGNC)\"\n Unique Values: \"2298\"\n Name: \"ann_type\"\n Description: \"Annotation Type\"\n Unique Values: \"10\"\n Name: \"start_pos\"\n Description: \"Start position of the gene on the chromosome\"\n Unique Values: \"1818\"\n Name: \"end_pos\"\n Description: \"End position of the gene on the chromosome\"\n Unique Values: \"1822\"\n Name: \"annotation\"\n Description: \"Function annotation from UniProtKB|RefSeq database\"\n Unique Values: \"2488\"\n Name: \"ecoid\"\n Description: \"Evidence & Conclusion Ontology (ECO) identifier\"\n Unique Values: \"10\"\n Name: \"ref_aa\"\n Description: \"Reference amino acid residue\"\n Unique Values: \"749\"\n Name: \"alt_aa\"\n Description: \"Altered amino acid residue\"\n Unique Values: \"129\"\n Name: \"xref_key\"\n Description: \"Source key associated to the xref_id\"\n Unique Values: \"2\"\n Name: \"xref_id\"\n Description: \"ID of the X-ref\"\n Unique Values: \"4137\"", "downloadurl": "/ln2data/releases/data/v-2.1.1/reviewed/fruitfly_protein_site_annotation_uniprotkb.csv" }