{ "uniprot_canonical_ac": "A0A0G2JZP9-1", "uniprot_ac": "A0A0G2JZP9", "uniprot_id": "A0A0G2JZP9_RAT", "mass": { "chemical_mass": 17444.0, "monoisotopic_mass": 17444.0 }, "refseq": { "ac": "NP_001258153", "name": "RING finger protein 11", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258153" }, "gene_names": [ { "name": "Rnf11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9", "id": "A0A0G2JZP9" }, { "name": "Rnf11l1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9", "id": "A0A0G2JZP9" }, { "name": "rCG_50351", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9", "id": "A0A0G2JZP9" } ], "protein_names": [ { "name": "RCG50351, isoform CRA_b", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9#names_and_taxonomy", "id": "A0A0G2JZP9" }, { "name": "Ring finger protein 11-like 1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9#names_and_taxonomy", "id": "A0A0G2JZP9" } ], "function": [ { "annotation": "Our findings demonstrate that RNF11 in neurons can modulate susceptibility to 6-OHDA toxicity through NF-kappaB mediated responses", "evidence": [ { "database": "RefSeq", "id": "NP_001258153", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258153" }, { "database": "PubMed", "id": "23318928", "url": "https://glygen.org/publication/PubMed/23318928" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9" } ], "common_name": "Rat" } ], "gene": [ { "name": "Rnf11", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9", "locus": {} } ], "crossref": [ { "id": "ENSRNOG00000057589", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000057589", "database": "Bgee" }, { "id": "cd16468", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16468", "database": "CDD" }, { "id": "100364162", "url": "https://www.ncbi.nlm.nih.gov/gene/100364162", "database": "GeneID" }, { "id": "IPR001841", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", "database": "InterPro" }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro" }, { "id": "IPR042981", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042981", "database": "InterPro" }, { "id": "HLDCIDN", "url": "https://omabrowser.org/oma/group/HLDCIDN/", "database": "OMA" }, { "id": "PF13639", "url": "http://pfam.xfam.org/family/PF13639", "database": "Pfam" }, { "id": "NP_001258153", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258153", "database": "RefSeq" }, { "id": "2321596", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=2321596", "database": "RGD" }, { "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9", "database": "UniProtKB" }, { "id": "A0A0G2JZP9-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN", "length": 154, "header": "tr|A0A0G2JZP9-1|A0A0G2JZP9_RAT Isoform 1 of Ring finger protein 11-like 1 OS=Rattus norvegicus OX=10116 GN=Rnf11 PE=1 SV=2 CANONICAL=A0A0G2JZP9-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JZP9-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9#A0A0G2JZP9-1", "sequence": { "sequence": "MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN", "length": 154, "header": "tr|A0A0G2JZP9-1|A0A0G2JZP9_RAT Isoform 1 of Ring finger protein 11-like 1 OS=Rattus norvegicus OX=10116 GN=Rnf11 PE=1 SV=2 CANONICAL=A0A0G2JZP9-1" }, "locus": { "chromosome": "5", "start_pos": 124234667, "end_pos": 124214130, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000080048.2", "url": "https://www.ensembl.org/id/ENSRNOT00000080048.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000071133.2", "url": "https://www.ensembl.org/id/ENSRNOP00000071133.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nat. Commun.", "date": "2012", "authors": "Olsen J.V., Lage K., Secher A., Dmytriyev A., Lundby A., Lundby C., Nordsborg N.B.", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "title": "RING finger protein 11 (RNF11) modulates susceptibility to 6-OHDA-induced nigral degeneration and behavioral deficits through NF-kappaB signaling in dopaminergic cells.", "journal": "Neurobiology of disease", "date": "2013", "authors": "Pranski EL, Dalal NV, Sanford CV, Herskowitz JH, Gearing M, Lazo C, Miller GW, Lah JJ, Levey AI, Betarbet RS", "evidence": [ { "database": "RefSeq", "id": "NP_001258153", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258153" } ], "reference": [ { "type": "PubMed", "id": "23318928", "url": "https://glygen.org/publication/PubMed/23318928" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "Q9QYK7-1", "protein_name": "RING finger protein 11", "gene_name": "Rnf11", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPIYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN", "length": 154 }, "evidence": [ { "id": "41497566", "url": "http://www.informatics.jax.org/homology/41497566", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Y3C5-1", "protein_name": "RING finger protein 11", "gene_name": "RNF11", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN", "length": 154 }, "evidence": [ { "id": "41497566", "url": "http://www.informatics.jax.org/homology/41497566", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9" } ], "pmid": "" }, { "name": "ubiquitin protein ligase activity", "id": "GO:0061630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "ubiquitin ligase complex", "id": "GO:0000151", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000151", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "ubiquitin-dependent protein catabolic process", "id": "GO:0006511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9" } ], "pmid": "" }, { "name": "protein autoubiquitination", "id": "GO:0051865", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051865", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2JZP9", "url": "https://www.uniprot.org/uniprot/A0A0G2JZP9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ] }