{
    "uniprot_canonical_ac": "A0A0B4JCZ1-1",
    "uniprot_ac": "A0A0B4JCZ1",
    "uniprot_id": "A0A0B4JCZ1_DROME",
    "mass": {
        "chemical_mass": 14009.0,
        "monoisotopic_mass": 14009.0
    },
    "refseq": {
        "ac": "NP_001189256",
        "name": "pre-mod(mdg4)-Z",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189256"
    },
    "gene_names": [
        {
            "name": "pre-mod(mdg4)-Z",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1",
            "id": "A0A0B4JCZ1"
        },
        {
            "name": "CG42770; Dmel\\CG42770",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189256",
            "id": "NP_001189256"
        },
        {
            "name": "CG42770",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1",
            "id": "A0A0B4JCZ1"
        },
        {
            "name": "Dmel\\CG42770",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1",
            "id": "A0A0B4JCZ1"
        },
        {
            "name": "Dmel_CG42770",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1",
            "id": "A0A0B4JCZ1"
        },
        {
            "name": "pre-mod(mdg4)-Z",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189256",
            "id": "NP_001189256"
        }
    ],
    "protein_names": [
        {
            "name": "CG42770-PA; pre-mod(mdg4)-Z-PA",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189256",
            "id": "NP_001189256"
        },
        {
            "name": "Pre-mod(Mdg4)-Z",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1#names_and_taxonomy",
            "id": "A0A0B4JCZ1"
        },
        {
            "name": "pre-mod(mdg4)-Z",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189256",
            "id": "NP_001189256"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Drosophila melanogaster",
            "taxid": 7227,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4JCZ1",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1"
                }
            ],
            "common_name": "Fruit fly"
        }
    ],
    "gene": [
        {
            "name": "pre-mod(mdg4)-Z",
            "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1",
            "locus": {
                "chromosome": "3R",
                "start_pos": 21360176,
                "end_pos": 21362131,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "FBgn0261838",
                        "url": "https://www.ensembl.org/id/FBgn0261838"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "FBgn0261838",
            "url": "https://bgee.org/?page=gene&gene_id=FBgn0261838",
            "database": "Bgee"
        },
        {
            "id": "FBgn0261838",
            "url": "https://flybase.org/reports/FBgn0261838",
            "database": "FlyBase"
        },
        {
            "id": "10178929",
            "url": "https://www.ncbi.nlm.nih.gov/gene/10178929",
            "database": "GeneID"
        },
        {
            "id": "IPR007588",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR007588",
            "database": "InterPro"
        },
        {
            "id": "dme:Dmel_CG42770",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG42770",
            "database": "KEGG Pathway"
        },
        {
            "id": "PF04500",
            "url": "http://pfam.xfam.org/family/PF04500",
            "database": "Pfam"
        },
        {
            "id": "NP_001189256",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001189256",
            "database": "RefSeq"
        },
        {
            "id": "A0A0B4JCZ1",
            "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1",
            "database": "UniProtKB"
        },
        {
            "id": "A0A0B4JCZ1-1",
            "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1-1",
            "database": "UniProtKB"
        }
    ],
    "sequence": {
        "sequence": "MQHVRNCGPQMFLISRKGGTLLTINNFVYRSNLKFFGKSNNILYWECVQNRSVKCRSRLKTIGDDLYVTNDVHNHMGDNKRIEAAKAAGMLIHKKLSSLTAADKIQGSWKMDTEGNPDHLPKM",
        "length": 123,
        "header": "tr|A0A0B4JCZ1-1|A0A0B4JCZ1_DROME Isoform 1 of Pre-mod(Mdg4)-Z  OS=Drosophila melanogaster OX=7227 GN=pre-mod(mdg4)-Z PE=4 SV=1 CANONICAL=A0A0B4JCZ1-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A0B4JCZ1-1",
            "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1#A0A0B4JCZ1-1",
            "sequence": {
                "sequence": "MQHVRNCGPQMFLISRKGGTLLTINNFVYRSNLKFFGKSNNILYWECVQNRSVKCRSRLKTIGDDLYVTNDVHNHMGDNKRIEAAKAAGMLIHKKLSSLTAADKIQGSWKMDTEGNPDHLPKM",
                "length": 123,
                "header": "tr|A0A0B4JCZ1-1|A0A0B4JCZ1_DROME Isoform 1 of Pre-mod(Mdg4)-Z  OS=Drosophila melanogaster OX=7227 GN=pre-mod(mdg4)-Z PE=4 SV=1 CANONICAL=A0A0B4JCZ1-1"
            },
            "locus": {
                "chromosome": "3R",
                "start_pos": 21361827,
                "end_pos": 21361400,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "FBtr0303402",
                        "url": "https://www.ensembl.org/id/FBtr0303402"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "FBpp0292463",
                        "url": "https://www.ensembl.org/id/FBpp0292463"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "The genome sequence of Drosophila melanogaster.",
            "journal": "Science",
            "date": "2000",
            "authors": "Adams M.D., Brottier P., Dew I., Dugan-Rocha S., Gibbs R.A., Gu Z., Kodira C.D., Lai Z., Li J., Li P.W., Li Z., Liu X., Muzny D.M., Myers E.W., Nusskern D.R., Reinert K., Scherer S.E., Shen H., Shue B.C., Sutton G.G., Turner R., Venter J.C., Wang X., Weissenbach J., Worley K.C., Yang S., Ye J., Zhan M., Zhang G., Zhang Q., Zhao Q., Zheng L., Zheng X.H., Zhou X., Bouck J., Durbin K.J., Nelson D.L., Richards S., Wu D., Dunn P., Kalush F., Lewis S.E., Mays A.D., Liang Y., Zhu X., Gocayne J.D., Kraft C., Wassarman D.A., Woodage T., Zhu S., Morris J., Downes M., Lin X., Murphy B., Deng Z., Champe M., Li J.H., Lei Y., Basu A., Davies P., Pan S., Smith T., Palazzolo M., Wei M.-H., Guan P., Puri V., Gorrell J.H., Doyle C., Karpen G.H., Rubin G.M., Bhandari D., Smith T.J., Nelson D.R., Gong F., Burtis K.C., Zhong W., Houck J., Wei M.H., Miklos G.L.G., Williams S.M., Wang A.H., Holt R.A., Kimmel B.E., Busam D.A., Weinstock G.M., Strong R., Simpson M., Wang Z.Y., An H.J., Wang Z.-Y., Harris N.L., Abril J.F., Baldwin D., Ballew R.M., Baxendale J., Center A., Dahlke C., Delcher A., Dodson K., Evans C.A., Ferriera S., Fosler C., Gabrielian A.E., Glasser K., Glodek A., Harris M., Heiman T.J., Hostin D., Ibegwam C., Ke Z., Ketchum K.A., Kravitz S., Mobarry C., Moy M., Remington K., Rogers Y.H., Smith H.O., Venter E., Wortman J.R., Ferraz C., Berman B.P., Stapleton M., Cawley S., Kulp D., Lasko P., Ashburner M., Fleischmann W., Amanatides P.G., Beeson K.Y., Davenport L.B., Dietz S.M., Evangelista C.C., Jalali M., Kraft C.L., Levitsky A.A., McIntosh T.C., Milshina N.V., Nelson K.A., Zhu S.C., Pollard J., McLeod M.P., Botchan M.R., Gelbart W.M., Mount S.M., Spradling A.C., Kennison J.A., Saunders R.D., Saunders R.D.C., Blazej R.G., Celniker S.E., Dunkov B.C., Galle R.F., George R.A., Harvey D.A., Hoskins R.A., Houston K.A., Reese M.G., Wan K.H., Butler H., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baxter E.G., Bayraktaroglu L., Beasley E.M., Benos P.V., Bolshakov S., Borkova D., Brandon R.C., Brokstein P., Cadieu E., Chandra I., Chen L.X., Cherry J.M., Doup L.E., Gabor G.L., Garg N.S., Harvey D., Helt G., Henderson S.N., Hernandez J.R., Howland T.J., Mattei B., McPherson D., Merkulov G., Moshrefi A., Murphy L., Nelson C.R., Nixon K., Pacleb J.M., Pfeiffer B.D., Pittman G.S., Rogers Y.-H.C., Scheeler F., Siden-Kiamos I., Skupski M.P., Spier E., Sun E., Svirskas R., Tector C., WoodageT, Yandell M.D., Yao Q.A., Yeh R.-F., Yeh R.F., Zaveri J.S., Zhong F.N., de Pablos B.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4JCZ1",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10731132",
                    "url": "https://glygen.org/publication/PubMed/10731132"
                }
            ]
        },
        {
            "title": "Finishing a whole-genome shotgun: release 3 of the Drosophila melanogaster euchromatic genome sequence.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Gibbs R.A., Muzny D.M., Myers E.W., Scherer S.E., Sutton G.G., Tabor P.E., Weinstock G., Wheeler D.A., Adams M., Hodgson A., Richards S., Patel S., Park S., Sodergren E.J., Champe M., Rubin G.M., Kronmiller B., Wan K., Halpern A., Stapleton M., Celniker S.E., George R.A., Hoskins R.A., Carlson J.W., Frise E., Laverty T., Nelson C.R., Pacleb J.M., Pfeiffer B.D., Svirskas R., Dugan S.P., Venter C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4JCZ1",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537568",
                    "url": "https://glygen.org/publication/PubMed/12537568"
                }
            ]
        },
        {
            "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Huang Y., Lewis S.E., Campbell K.S., Russo S., Rubin G.M., Misra S., Richter J., Yamada C., Harris N.L., Smith C.D., Berman B.P., Stapleton M., Ashburner M., Gelbart W.M., Schroeder A.J., Celniker S.E., Bayraktaroglu L., Bettencourt B.R., Crosby M.A., Drysdale R.A., Hradecky P., Kaminker J.S., Matthews B.B., Millburn G.H., Mungall C.J., Prochnik S.E., Shu S.Q., Tupy J.L., Whitfied E.J., Whitfield E.J., de Grey A.D., de Grey A.D.N.J.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4JCZ1",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537572",
                    "url": "https://glygen.org/publication/PubMed/12537572"
                }
            ]
        },
        {
            "title": "The transposable elements of the Drosophila melanogaster euchromatin: a genomics perspective.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Wheeler D.A., Lewis S.E., Patel S., Carlson J., Rubin G.M., Kronmiller B., Ashburner M., Celniker S.E., Frise E., Kaminker J.S., Svirskas R., Bergman C.M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4JCZ1",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537573",
                    "url": "https://glygen.org/publication/PubMed/12537573"
                }
            ]
        },
        {
            "title": "Heterochromatic sequences in a Drosophila whole-genome shotgun assembly.",
            "journal": "Genome Biol.",
            "date": "2002",
            "authors": "Myers E.W., Sutton G.G., Karpen G.H., Sullivan B.A., Rubin G.M., Kennedy C., Halpern A., Smith C.D., Wakimoto B.T., Carvalho A.B., Celniker S.E., Hoskins R.A., Carlson J.W., Kaminker J.S., Mungall C.J., Yasuhara J.C.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4JCZ1",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12537574",
                    "url": "https://glygen.org/publication/PubMed/12537574"
                }
            ]
        },
        {
            "title": "Combined evidence annotation of transposable elements in genome sequences.",
            "journal": "PLoS Comput. Biol.",
            "date": "2005",
            "authors": "Ashburner M., Anxolabehere D., Andrieu O., Autard D., Bergman C.M., Nouaud D., Quesneville H.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4JCZ1",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16110336",
                    "url": "https://glygen.org/publication/PubMed/16110336"
                }
            ]
        },
        {
            "title": "The Release 5.1 annotation of Drosophila melanogaster heterochromatin.",
            "journal": "Science",
            "date": "2007",
            "authors": "Shu S., Karpen G.H., Smith C.D., Mungall C.J.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4JCZ1",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17569856",
                    "url": "https://glygen.org/publication/PubMed/17569856"
                }
            ]
        },
        {
            "title": "Sequence finishing and mapping of Drosophila melanogaster heterochromatin.",
            "journal": "Science",
            "date": "2007",
            "authors": "Rossi F., Park S., Villasante A., Karpen G.H., Dimitri P., Kennedy C., Celniker S.E., Hoskins R.A., Wan K.H., Carlson J.W., Evans-Holm M., Frise E., Acevedo D., Mendez-Lago M.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0B4JCZ1",
                    "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17569867",
                    "url": "https://glygen.org/publication/PubMed/17569867"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "dme:Dmel_CG42770",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG42770",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "metal ion binding",
                        "id": "GO:0046872",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A0B4JCZ1",
                                "url": "https://www.uniprot.org/uniprot/A0A0B4JCZ1"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 50,
            "end_pos": 52,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "synthesized_glycans": [],
    "cluster_types": []
}