{ "uniprot_canonical_ac": "A0A0G2K899-1", "uniprot_ac": "A0A0G2K899", "uniprot_id": "A0A0G2K899_RAT", "mass": { "chemical_mass": 17448.0, "monoisotopic_mass": 17448.0 }, "refseq": { "ac": "NP_001100216", "name": "acylphosphatase-1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100216" }, "gene_names": [ { "name": "Acyp1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K899", "id": "A0A0G2K899" }, { "name": "Acyp1_predicted", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2K899", "id": "A0A0G2K899" }, { "name": "Acyp1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100216", "id": "NP_001100216" }, { "name": "rCG_20688", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2K899", "id": "A0A0G2K899" } ], "protein_names": [ { "name": "Acylphosphatase", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K899#names_and_taxonomy", "id": "A0A0G2K899" }, { "name": "3.6.1.7", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2K899#names_and_taxonomy", "id": "A0A0G2K899" }, { "name": "acylphosphatase 1, erythrocyte (common) type", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100216", "id": "NP_001100216" }, { "name": "acylphosphatase-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100216", "id": "NP_001100216" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K899", "url": "https://www.uniprot.org/uniprot/A0A0G2K899" } ], "common_name": "Rat" } ], "gene": [ { "name": "Acyp1", "url": "https://www.uniprot.org/uniprot/A0A0G2K899", "locus": { "chromosome": "6", "start_pos": 109104050, "end_pos": 109097065, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000006744", "url": "https://www.ensembl.org/id/ENSRNOG00000006744" } ] } } ], "crossref": [ { "id": "ENSRNOG00000006744", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000006744", "database": "Bgee" }, { "id": "299203", "url": "https://www.ncbi.nlm.nih.gov/gene/299203", "database": "GeneID" }, { "id": "IPR001792", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001792", "database": "InterPro" }, { "id": "IPR017968", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017968", "database": "InterPro" }, { "id": "IPR020456", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020456", "database": "InterPro" }, { "id": "IPR036046", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036046", "database": "InterPro" }, { "id": "rno:299203", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:299203", "database": "KEGG Pathway" }, { "id": "FRKYTQG", "url": "https://omabrowser.org/oma/group/FRKYTQG/", "database": "OMA" }, { "id": "1502266at2759", "url": "http://www.orthodb.org/?query=1502266at2759", "database": "OrthoDB" }, { "id": "PTHR10029", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10029", "database": "PANTHER" }, { "id": "PF00708", "url": "http://pfam.xfam.org/family/PF00708", "database": "Pfam" }, { "id": "NP_001100216", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100216", "database": "RefSeq" }, { "id": "1311327", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1311327", "database": "RGD" }, { "id": "14965", "url": "https://www.rhea-db.org/rhea/14965", "database": "Rhea" }, { "id": "A0A0G2K899", "url": "https://www.uniprot.org/uniprot/A0A0G2K899", "database": "UniProtKB" }, { "id": "A0A0G2K899-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K899-1", "database": "UniProtKB" }, { "id": "D4A6X4", "url": "https://www.uniprot.org/uniprot/D4A6X4", "database": "UniProtKB" }, { "id": "D4A6X4-1", "url": "https://www.uniprot.org/uniprot/D4A6X4-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MMLPDLRVCPCLEKGGALRWALDSSRPRIRGSVGLAGVGLLITLLSTLRYCAQAPGLSMAEGDTLVSVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTNRGTVQGQLQGPVSKVRFMQEWLEKRGSPKSHIDRANFNNEKIISNLDYSDFQIIK", "length": 157, "header": "tr|A0A0G2K899-1|A0A0G2K899_RAT Isoform 1 of Acylphosphatase OS=Rattus norvegicus OX=10116 GN=Acyp1 PE=1 SV=1 CANONICAL=A0A0G2K899-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K899-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K899#A0A0G2K899-1", "sequence": { "sequence": "MMLPDLRVCPCLEKGGALRWALDSSRPRIRGSVGLAGVGLLITLLSTLRYCAQAPGLSMAEGDTLVSVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTNRGTVQGQLQGPVSKVRFMQEWLEKRGSPKSHIDRANFNNEKIISNLDYSDFQIIK", "length": 157, "header": "tr|A0A0G2K899-1|A0A0G2K899_RAT Isoform 1 of Acylphosphatase OS=Rattus norvegicus OX=10116 GN=Acyp1 PE=1 SV=1 CANONICAL=A0A0G2K899-1" }, "locus": { "chromosome": "6", "start_pos": 104932276, "end_pos": 104919363, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000080009.2", "url": "https://www.ensembl.org/id/ENSRNOT00000080009.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000074525.2", "url": "https://www.ensembl.org/id/ENSRNOP00000074525.2" } ] } }, { "isoform_ac": "D4A6X4-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K899#D4A6X4-1", "sequence": { "sequence": "MAEGDTLVSVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTNRGTVQGQLQGPVSKVRFMQEWLEKRGSPKSHIDRANFNNEKIISNLDYSDFQIIK", "length": 99, "header": "tr|D4A6X4-1|D4A6X4_RAT Computationally mapped isoform of Acylphosphatase OS=Rattus norvegicus OX=10116 GN=Acyp1 PE=1 SV=1 CANONICAL=A0A0G2K899-1" }, "locus": { "chromosome": "6", "start_pos": 104925777, "end_pos": 104919363, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000009086.7", "url": "https://www.ensembl.org/id/ENSRNOT00000009086.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000009086.5", "url": "https://www.ensembl.org/id/ENSRNOP00000009086.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.", "journal": "Briefings in bioinformatics", "date": "2011", "authors": "Gaudet P, Livstone MS, Lewis SE, Thomas PD", "evidence": [ { "database": "RefSeq", "id": "NP_001100216", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001100216" } ], "reference": [ { "type": "PubMed", "id": "21873635", "url": "https://glygen.org/publication/PubMed/21873635" } ] } ], "pathway": [ { "id": "rno:299203", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:299203", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P07311-1", "protein_name": "Acylphosphatase-1", "gene_name": "ACYP1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK", "length": 99 }, "evidence": [ { "id": "41492085", "url": "http://www.informatics.jax.org/homology/41492085", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P56376-1", "protein_name": "Acylphosphatase-1", "gene_name": "Acyp1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAEGDTLVSVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDRGTVQGQLQGPVSKVRFMQQWLETRGSPKSHIDRANFNNEKVIANLDYSDFQIVK", "length": 99 }, "evidence": [ { "id": "41492085", "url": "http://www.informatics.jax.org/homology/41492085", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "acylphosphatase activity", "id": "GO:0003998", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003998", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K899", "url": "https://www.uniprot.org/uniprot/A0A0G2K899" } ], "pmid": "21873635" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "14965", "name": "", "equation": "an acyl phosphate + H2O = a carboxylate + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P35745-1", "A0A0G2K899-1", "P14621-1", "P07311-1", "P56375-1", "P56376-1", "Q9VF36-1", "P56544-1", "A1A6Q5-1", "Q4V6I0-1", "Q9VHX3-1" ], "evidence": [ { "id": "14965", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/14965" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K899", "gene_name": "Acyp1", "activity": [ { "ec_number": "3.6.1.7", "activity": "an acyl phosphate + H2O = a carboxylate + H(+) + phosphate.", "evidence": [ { "id": "A0A0G2K899", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K899" } ] }, { "ec_number": "3.6.1.7", "activity": "", "evidence": [ { "id": "A0A0G2K899", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K899" } ] } ] }, { "uniprot_ac": "A1A6Q5", "gene_name": "Dmel\\CG34161", "activity": [ { "ec_number": "3.6.1.7", "activity": "an acyl phosphate + H2O = a carboxylate + H(+) + phosphate.", "evidence": [ { "id": "A1A6Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1A6Q5" } ] }, { "ec_number": "3.6.1.7", "activity": "", "evidence": [ { "id": "A1A6Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1A6Q5" } ] } ] }, { "uniprot_ac": "P07311", "gene_name": "ACYP1", "activity": [ { "ec_number": "3.6.1.7", "activity": "an acyl phosphate + H2O = a carboxylate + H(+) + phosphate.", "evidence": [ { "id": "P07311", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07311" } ] }, { "ec_number": "3.6.1.7", "activity": "", "evidence": [ { "id": "P07311", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07311" } ] } ] }, { "uniprot_ac": "P14621", "gene_name": "ACYP2", "activity": [ { "ec_number": "3.6.1.7", "activity": "an acyl phosphate + H2O = a carboxylate + H(+) + phosphate.", "evidence": [ { "id": "P14621", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14621" } ] }, { "ec_number": "3.6.1.7", "activity": "", "evidence": [ { "id": "P14621", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14621" } ] } ] }, { "uniprot_ac": "P35745", "gene_name": "Acyp2", "activity": [ { "ec_number": "3.6.1.7", "activity": "an acyl phosphate + H2O = a carboxylate + H(+) + phosphate.", "evidence": [ { "id": "P35745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35745" } ] }, { "ec_number": "3.6.1.7", "activity": "", "evidence": [ { "id": "P35745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35745" } ] } ] }, { "uniprot_ac": "P56375", "gene_name": "Acyp2", "activity": [ { "ec_number": "3.6.1.7", "activity": "an acyl phosphate + H2O = a carboxylate + H(+) + phosphate.", "evidence": [ { "id": "P56375", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56375" } ] }, { "ec_number": "3.6.1.7", "activity": "", "evidence": [ { "id": "P56375", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56375" } ] } ] }, { "uniprot_ac": "P56376", "gene_name": "Acyp1", "activity": [ { "ec_number": "3.6.1.7", "activity": "an acyl phosphate + H2O = a carboxylate + H(+) + phosphate.", "evidence": [ { "id": "P56376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56376" } ] }, { "ec_number": "3.6.1.7", "activity": "", "evidence": [ { "id": "P56376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56376" } ] } ] }, { "uniprot_ac": "P56544", "gene_name": "Acyp", "activity": [ { "ec_number": "3.6.1.7", "activity": "an acyl phosphate + H2O = a carboxylate + H(+) + phosphate.", "evidence": [ { "id": "P56544", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56544" } ] }, { "ec_number": "3.6.1.7", "activity": "", "evidence": [ { "id": "P56544", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56544" } ] } ] }, { "uniprot_ac": "Q4V6I0", "gene_name": "CG18371-RA", "activity": [ { "ec_number": "3.6.1.7", "activity": "an acyl phosphate + H2O = a carboxylate + H(+) + phosphate.", "evidence": [ { "id": "Q4V6I0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V6I0" } ] }, { "ec_number": "3.6.1.7", "activity": "", "evidence": [ { "id": "Q4V6I0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V6I0" } ] } ] }, { "uniprot_ac": "Q9VF36", "gene_name": "Acyp2", "activity": [ { "ec_number": "3.6.1.7", "activity": "an acyl phosphate + H2O = a carboxylate + H(+) + phosphate.", "evidence": [ { "id": "Q9VF36", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VF36" } ] }, { "ec_number": "3.6.1.7", "activity": "", "evidence": [ { "id": "Q9VF36", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VF36" } ] } ] }, { "uniprot_ac": "Q9VHX3", "gene_name": "Dmel\\CG11052", "activity": [ { "ec_number": "3.6.1.7", "activity": "an acyl phosphate + H2O = a carboxylate + H(+) + phosphate.", "evidence": [ { "id": "Q9VHX3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHX3" } ] }, { "ec_number": "3.6.1.7", "activity": "", "evidence": [ { "id": "Q9VHX3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHX3" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ] }