{ "uniprot_canonical_ac": "A0A0G2K7P4-1", "uniprot_ac": "A0A0G2K7P4", "uniprot_id": "A0A0G2K7P4_RAT", "mass": { "chemical_mass": 35268.0, "monoisotopic_mass": 35268.0 }, "refseq": { "ac": "NP_001296097", "name": "thioredoxin-like protein 4A", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296097" }, "gene_names": [ { "name": "RGD1560212", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4", "id": "A0A0G2K7P4" }, { "name": "Txnl4a", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4", "id": "A0A0G2K7P4" }, { "name": "RGD1560212_predicted", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4", "id": "A0A0G2K7P4" }, { "name": "Txnl4a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296097", "id": "NP_001296097" }, { "name": "Txnl4a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4", "id": "A0A0G2K7P4" }, { "name": "Txnl4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296097", "id": "NP_001296097" }, { "name": "rCG_20515", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4", "id": "A0A0G2K7P4" } ], "protein_names": [ { "name": "N-terminal amino-acid N(alpha)-acetyltransferase NatA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4#names_and_taxonomy", "id": "A0A0G2K7P4" }, { "name": "2.3.1.255", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4#names_and_taxonomy", "id": "A0A0G2K7P4" }, { "name": "similar to DNA segment, Chr 18, Wayne State University 98, expressed", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071144", "id": "NP_001071144" }, { "name": "thioredoxin-like protein 4A-like", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296097", "id": "NP_001296097" }, { "name": "thioredoxin-like protein 4A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296097", "id": "NP_001296097" } ], "function": [ { "annotation": "Plays role in pre-mRNA splicing.", "evidence": [ { "database": "UniProtKB", "id": "D3ZSW5", "url": "https://www.uniprot.org/uniprot/D3ZSW5#function" }, { "database": "PubMed", "id": "PIRNR017199", "url": "https://glygen.org/publication/PubMed/PIRNR017199" } ] } ], "disease": [ { "disease_id": "DOID:0050781", "recommended_name": { "id": "DOID:0050781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050781", "name": "Ogden syndrome", "description": "A syndrome characterized by postnatal growth failure, severely delayed psychomotor development, variable dysmorphic features, and hypotonia and has_material_basis_in X-linked recessive or X-linked dominant mutation in the NAA10 gene on chromosome Xq28." }, "synonyms": [ { "id": "DOID:0050781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050781", "name": "N-alpha-acetyltransferase", "description": "" }, { "id": "DOID:0050781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050781", "name": "N-terminal acetyltransferase deficiency", "description": "" }, { "id": "DOID:0050781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050781", "name": "OGDNS", "description": "" }, { "id": "DOID:0050781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050781", "name": "X-linked Malformation and Infantile Lethality Syndrome", "description": "" }, { "id": "MONDO:0010457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010457", "name": "Ogden syndrome", "description": "Ogden syndrome is a rare, genetic progeroid syndrome characterized by a variable phenotype including postnatal growth delay, severe global developmental delay, hypotonia, non-specific dysmorphic facies with aged appearance and cryptorchidism, as well as cardiac arrthymias and skeletal anomalies. Patients typically present with widely opened fontanels, mainly truncal hypotonia, a waddling gait with hypertonia of the extremities, small hands and feet, broad great toes, scoliosis and redundant skin with lack of subcutaneous fat." }, { "id": "MONDO:0010457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010457", "name": "NAT1 deficiency", "description": "" }, { "id": "MONDO:0010457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010457", "name": "N acetyltransferase deficiency", "description": "" }, { "id": "MONDO:0010457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010457", "name": "Acetyl-CoA:arylamine n-acetyltransferase", "description": "" }, { "id": "MONDO:0010457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010457", "name": "arylamine n-acetyltransferase 1", "description": "" }, { "id": "MONDO:0010457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010457", "name": "Ogden syndrome; OGDNS", "description": "" }, { "id": "MONDO:0010457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010457", "name": "N acetyltransferase 1 deficiency", "description": "" }, { "id": "MONDO:0010457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010457", "name": "X-linked malformation and infantile lethality syndrome", "description": "" }, { "id": "MONDO:0010457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010457", "name": "OGDNS", "description": "" }, { "id": "MONDO:0010457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010457", "name": "Ogden syndrome", "description": "" }, { "id": "MONDO:0010457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010457", "name": "N-terminal acetyltransferase deficiency", "description": "" }, { "id": "MONDO:0010457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010457", "name": "N-alpha-acetyltransferase", "description": "" }, { "id": "MONDO:0010457", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010457", "name": "premature aging appearance-developmental delay-cardiac arrhythmia syndrome", "description": "" }, { "id": "MIM:300855", "resource": "MIM", "url": "https://www.omim.org/entry/300855", "name": "N-terminal acetyltransferase deficiency", "description": "N-terminal acetyltransferase deficiency" } ], "evidence": [ { "id": "0050781", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050781" } ] }, { "disease_id": "DOID:0080695", "recommended_name": { "id": "DOID:0080695", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080695", "name": "Burn-McKeown syndrome", "description": "A syndrome that is characterized by bilateral choanal atresia, cranio-facial dysmorphism, hearing loss, heart abnormalities, and short stature." }, "synonyms": [ { "id": "DOID:0080695", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080695", "name": "Choanal atresia - deafness - cardiac defects - dysmorphism syndrome", "description": "" }, { "id": "MONDO:0012064", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012064", "name": "choanal atresia-hearing loss-cardiac defects-craniofacial dysmorphism syndrome", "description": "Choanal atresia - deafness - cardiac defects - dysmorphism syndrome, also known as Burn-McKeown syndrome, is an extremely rare multiple congenital anomaly syndrome characterized by bilateral choanal atresia (see this term) associated with a characteristic cranio-facial dysmorphism (hypertelorism with narrow palpebral fissures, coloboma of inferior eyelid (see this term) with presence of eyelashes medial to the defect, prominent nasal bridge, thin lips, prominent ears), that can be accompanied by hearing loss, unilateral cleft lip, preauricular tags, cardiac septal defects and anomalies of the kidneys. The features of this syndrome overlaps considerably with those of the CHARGE syndrome (see this term)." }, { "id": "MONDO:0012064", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012064", "name": "choanal atresia deafness cardiac defects dysmorphism", "description": "" }, { "id": "MONDO:0012064", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012064", "name": "BURN-McKeown syndrome", "description": "" }, { "id": "MONDO:0012064", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012064", "name": "Burn-McKeown syndrome", "description": "" }, { "id": "MONDO:0012064", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012064", "name": "BURN-McKeown syndrome; BMKS", "description": "" }, { "id": "MONDO:0012064", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012064", "name": "BMKS", "description": "" }, { "id": "MONDO:0012064", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012064", "name": "oculootofacial dysplasia", "description": "" }, { "id": "MONDO:0012064", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012064", "name": "bilateral choanal atresia, cardiac defects, deafness, and dysmorphic appearance", "description": "" }, { "id": "MIM:608572", "resource": "MIM", "url": "https://www.omim.org/entry/608572", "name": "Burn-McKeown syndrome", "description": "Burn-McKeown syndrome" } ], "evidence": [ { "id": "0080695", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080695" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7P4", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4" } ], "common_name": "Rat" } ], "gene": [ { "name": "Txnl4a", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4", "locus": { "chromosome": "18", "start_pos": 76725247, "end_pos": 76740688, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000052004", "url": "https://www.ensembl.org/id/ENSRNOG00000052004" } ] } } ], "crossref": [ { "id": "ENSRNOG00000052004", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000052004", "database": "Bgee" }, { "id": "ENSRNOG00000057774", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000057774", "database": "Bgee" }, { "id": "cd02954", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02954", "database": "CDD" }, { "id": "100911462", "url": "https://www.ncbi.nlm.nih.gov/gene/100911462", "database": "GeneID" }, { "id": "498890", "url": "https://www.ncbi.nlm.nih.gov/gene/498890", "database": "GeneID" }, { "id": "IPR000182", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000182", "database": "InterPro" }, { "id": "IPR004123", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004123", "database": "InterPro" }, { "id": "IPR016181", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016181", "database": "InterPro" }, { "id": "IPR036249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036249", "database": "InterPro" }, { "id": "IPR045047", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045047", "database": "InterPro" }, { "id": "rno:100911462", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:100911462", "database": "KEGG Pathway" }, { "id": "rno:498890", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:498890", "database": "KEGG Pathway" }, { "id": "DFNEMYE", "url": "https://omabrowser.org/oma/group/DFNEMYE/", "database": "OMA" }, { "id": "ETFGAHY", "url": "https://omabrowser.org/oma/group/ETFGAHY/", "database": "OMA" }, { "id": "1489230at2759", "url": "http://www.orthodb.org/?query=1489230at2759", "database": "OrthoDB" }, { "id": "PTHR12052", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12052", "database": "PANTHER" }, { "id": "PTHR23091", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23091", "database": "PANTHER" }, { "id": "PF00583", "url": "http://pfam.xfam.org/family/PF00583", "database": "Pfam" }, { "id": "PF02966", "url": "http://pfam.xfam.org/family/PF02966", "database": "Pfam" }, { "id": "NP_001071144", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071144", "database": "RefSeq" }, { "id": "NP_001296097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296097", "database": "RefSeq" }, { "id": "1560212", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1560212", "database": "RGD" }, { "id": "6492735", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=6492735", "database": "RGD" }, { "id": "50496", "url": "https://www.rhea-db.org/rhea/50496", "database": "Rhea" }, { "id": "50500", "url": "https://www.rhea-db.org/rhea/50500", "database": "Rhea" }, { "id": "50504", "url": "https://www.rhea-db.org/rhea/50504", "database": "Rhea" }, { "id": "50508", "url": "https://www.rhea-db.org/rhea/50508", "database": "Rhea" }, { "id": "50512", "url": "https://www.rhea-db.org/rhea/50512", "database": "Rhea" }, { "id": "50516", "url": "https://www.rhea-db.org/rhea/50516", "database": "Rhea" }, { "id": "A0A0G2K7P4", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4", "database": "UniProtKB" }, { "id": "A0A0G2K7P4-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4-1", "database": "UniProtKB" }, { "id": "A0JPQ5", "url": "https://www.uniprot.org/uniprot/A0JPQ5", "database": "UniProtKB" }, { "id": "A0JPQ5-1", "url": "https://www.uniprot.org/uniprot/A0JPQ5-1", "database": "UniProtKB" }, { "id": "D3ZSW5", "url": "https://www.uniprot.org/uniprot/D3ZSW5", "database": "UniProtKB" }, { "id": "D3ZSW5-1", "url": "https://www.uniprot.org/uniprot/D3ZSW5-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKIFLILCESCLDIPAVLKQTVLVSLVLCGILSDSRGLTGLPAASMNIRRARPDDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFSAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLSQMADELRRQLVLKKGRYVVLGSKENQGSTLPGSEEACQQENLAVGDSGSDGKDSTDVQDSLQTLGSAS", "length": 314, "header": "tr|A0A0G2K7P4-1|A0A0G2K7P4_RAT Isoform 1 of N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Rattus norvegicus OX=10116 GN=Txnl4a PE=1 SV=1 CANONICAL=A0A0G2K7P4-1" }, "isoforms": [ { "isoform_ac": "A0A0G2K7P4-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4#A0A0G2K7P4-1", "sequence": { "sequence": "MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKIFLILCESCLDIPAVLKQTVLVSLVLCGILSDSRGLTGLPAASMNIRRARPDDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFSAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLSQMADELRRQLVLKKGRYVVLGSKENQGSTLPGSEEACQQENLAVGDSGSDGKDSTDVQDSLQTLGSAS", "length": 314, "header": "tr|A0A0G2K7P4-1|A0A0G2K7P4_RAT Isoform 1 of N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Rattus norvegicus OX=10116 GN=Txnl4a PE=1 SV=1 CANONICAL=A0A0G2K7P4-1" }, "locus": { "chromosome": "18", "start_pos": 73664918, "end_pos": 73659512, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000082419.2", "url": "https://www.ensembl.org/id/ENSRNOT00000082419.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000074289.2", "url": "https://www.ensembl.org/id/ENSRNOP00000074289.2" } ] } }, { "isoform_ac": "A0JPQ5-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4#A0JPQ5-1", "sequence": { "sequence": "MNIRRARPDDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFSAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLSQMADELRRQLVLKKGRYVVLGSKENQGSTLPGSEEACQQENLAVGDSGSDGKDSTDVQDSLQTLGSAS", "length": 220, "header": "tr|A0JPQ5-1|A0JPQ5_RAT Computationally mapped isoform of N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Rattus norvegicus OX=10116 GN=RGD1560212 PE=1 SV=1 CANONICAL=A0A0G2K7P4-1" }, "locus": { "chromosome": "18", "start_pos": 73664918, "end_pos": 73664259, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000117773.1", "url": "https://www.ensembl.org/id/ENSRNOT00000117773.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000096609.1", "url": "https://www.ensembl.org/id/ENSRNOP00000096609.1" } ] } }, { "isoform_ac": "D3ZSW5-1", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4#D3ZSW5-1", "sequence": { "sequence": "MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY", "length": 142, "header": "tr|D3ZSW5-1|D3ZSW5_RAT Computationally mapped isoform of Thioredoxin-like protein OS=Rattus norvegicus OX=10116 GN=Txnl4a PE=1 SV=1 CANONICAL=A0A0G2K7P4-1" }, "locus": { "chromosome": "18", "start_pos": 73674712, "end_pos": 73659512, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000089487.2", "url": "https://www.ensembl.org/id/ENSRNOT00000089487.2" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000073923.1", "url": "https://www.ensembl.org/id/ENSRNOP00000073923.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Minor spliceosome components are predominantly localized in the nucleus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Pessa HK, Will CL, Meng X, Schneider C, Watkins NJ, Perala N, Nymark M, Turunen JJ, Luhrmann R, Frilander MJ", "evidence": [ { "database": "RefSeq", "id": "NP_001296097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296097" } ], "reference": [ { "type": "PubMed", "id": "18559850", "url": "https://glygen.org/publication/PubMed/18559850" } ] }, { "title": "Molecular architecture of the human U4/U6.U5 tri-snRNP.", "journal": "Science (New York, N.Y.)", "date": "2016", "authors": "Agafonov DE, Kastner B, Dybkov O, Hofele RV, Liu WT, Urlaub H, Luhrmann R, Stark H", "evidence": [ { "database": "RefSeq", "id": "NP_001296097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296097" } ], "reference": [ { "type": "PubMed", "id": "26912367", "url": "https://glygen.org/publication/PubMed/26912367" } ] }, { "title": "Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.", "journal": "Cell", "date": "2017", "authors": "Bertram K, Agafonov DE, Dybkov O, Haselbach D, Leelaram MN, Will CL, Urlaub H, Kastner B, Luhrmann R, Stark H", "evidence": [ { "database": "RefSeq", "id": "NP_001296097", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001296097" } ], "reference": [ { "type": "PubMed", "id": "28781166", "url": "https://glygen.org/publication/PubMed/28781166" } ] } ], "pathway": [ { "id": "rno:100911462", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:100911462", "resource": "KEGG Pathway" }, { "id": "rno:498890", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:498890", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P83876-1", "protein_name": "Thioredoxin-like protein 4A", "gene_name": "TXNL4A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY", "length": 142 }, "evidence": [ { "id": "41495494", "url": "http://www.informatics.jax.org/homology/41495494", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P83877-1", "protein_name": "Thioredoxin-like protein 4A", "gene_name": "Txnl4a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY", "length": 142 }, "evidence": [ { "id": "41495494", "url": "http://www.informatics.jax.org/homology/41495494", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BSU3-1", "protein_name": "N-alpha-acetyltransferase 11", "gene_name": "NAA11", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEEPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRPALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLSQMADELRRQMDLKKGGYVVLGSRENQETQGSTLSDSEEACQQKNPATEESGSDSKEPKESVESTNVQDSSESSDSTS", "length": 229 }, "evidence": [ { "id": "41499678", "url": "http://www.informatics.jax.org/homology/41499678", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7P4", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7P4", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4" } ], "pmid": "" }, { "name": "U5 snRNP", "id": "GO:0005682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005682", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7P4", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4" } ], "pmid": "" }, { "name": "U4/U6 x U5 tri-snRNP complex", "id": "GO:0046540", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046540", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7P4", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4" } ], "pmid": "" }, { "name": "U2-type precatalytic spliceosome", "id": "GO:0071005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071005", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7P4", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4" } ], "pmid": "" }, { "name": "NatA complex", "id": "GO:0031415", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031415", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7P4", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4" } ], "pmid": "21873635" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "mRNA splicing, via spliceosome", "id": "GO:0000398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000398", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7P4", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4" } ], "pmid": "" }, { "name": "N-terminal protein amino acid acetylation", "id": "GO:0006474", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006474", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7P4", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "peptide-serine-N-acetyltransferase activity", "id": "GO:1990189", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990189", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7P4", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4" } ], "pmid": "21873635" }, { "name": "peptide-glutamate-N-acetyltransferase activity", "id": "GO:1990190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990190", "evidence": [ { "database": "UniProtKB", "id": "A0A0G2K7P4", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4" } ], "pmid": "21873635" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 195, "end_pos": 197, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "50496", "name": "", "equation": "acetyl-CoA + N-terminal glycyl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetylglycyl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K7P4-1", "A0A8I6A9B2-1", "Q4V8K3-1", "Q9BSU3-1", "P41227-1", "Q3UX61-1", "Q9QY36-1", "Q9CQX6-1", "Q9VT75-1" ], "evidence": [ { "id": "50496", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50496" } ] }, { "id": "50500", "name": "", "equation": "acetyl-CoA + N-terminal L-alanyl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetyl-L-alanyl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K7P4-1", "A0A8I6A9B2-1", "Q4V8K3-1", "Q9BSU3-1", "P41227-1", "Q3UX61-1", "Q9QY36-1", "Q9CQX6-1", "Q9VT75-1" ], "evidence": [ { "id": "50500", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50500" } ] }, { "id": "50504", "name": "", "equation": "acetyl-CoA + N-terminal L-seryl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetyl-L-seryl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K7P4-1", "A0A8I6A9B2-1", "Q4V8K3-1", "Q9BSU3-1", "P41227-1", "Q3UX61-1", "Q9QY36-1", "Q9CQX6-1", "Q9VT75-1" ], "evidence": [ { "id": "50504", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50504" } ] }, { "id": "50508", "name": "", "equation": "acetyl-CoA + N-terminal L-valyl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetyl-L-valyl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K7P4-1", "A0A8I6A9B2-1", "Q4V8K3-1", "Q9BSU3-1", "P41227-1", "Q3UX61-1", "Q9QY36-1", "Q9CQX6-1", "Q9VT75-1" ], "evidence": [ { "id": "50508", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50508" } ] }, { "id": "50512", "name": "", "equation": "acetyl-CoA + N-terminal L-cysteinyl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetyl-L-cysteinyl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K7P4-1", "A0A8I6A9B2-1", "Q4V8K3-1", "Q9BSU3-1", "P41227-1", "Q3UX61-1", "Q9QY36-1", "Q9CQX6-1", "Q9VT75-1" ], "evidence": [ { "id": "50512", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50512" } ] }, { "id": "50516", "name": "", "equation": "acetyl-CoA + N-terminal L-threonyl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetyl-L-threonyl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K7P4-1", "A0A8I6A9B2-1", "Q4V8K3-1", "Q9BSU3-1", "P41227-1", "Q3UX61-1", "Q9QY36-1", "Q9CQX6-1", "Q9VT75-1" ], "evidence": [ { "id": "50516", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50516" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K7P4", "gene_name": "Txnl4a", "activity": [ { "ec_number": "2.3.1.255", "activity": "acetyl-CoA + N-terminal glycyl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetylglycyl-[protein].", "evidence": [ { "id": "A0A0G2K7P4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4" } ] }, { "ec_number": "2.3.1.255", "activity": "", "evidence": [ { "id": "A0A0G2K7P4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K7P4" } ] } ] }, { "uniprot_ac": "A0A8I6A9B2", "gene_name": "Naa10", "activity": [ { "ec_number": "2.3.1.255", "activity": "acetyl-CoA + N-terminal glycyl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetylglycyl-[protein].", "evidence": [ { "id": "A0A8I6A9B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A9B2" } ] }, { "ec_number": "2.3.1.255", "activity": "", "evidence": [ { "id": "A0A8I6A9B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A9B2" } ] } ] }, { "uniprot_ac": "P41227", "gene_name": "NAA10", "activity": [ { "ec_number": "2.3.1.255", "activity": "acetyl-CoA + N-terminal glycyl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetylglycyl-[protein].", "evidence": [ { "id": "P41227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41227" } ] }, { "ec_number": "2.3.1.255", "activity": "", "evidence": [ { "id": "P41227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41227" } ] } ] }, { "uniprot_ac": "Q3UX61", "gene_name": "Naa11", "activity": [ { "ec_number": "2.3.1.255", "activity": "acetyl-CoA + N-terminal glycyl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetylglycyl-[protein].", "evidence": [ { "id": "Q3UX61", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UX61" } ] }, { "ec_number": "2.3.1.255", "activity": "", "evidence": [ { "id": "Q3UX61", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UX61" } ] } ] }, { "uniprot_ac": "Q4V8K3", "gene_name": "Naa11", "activity": [ { "ec_number": "2.3.1.255", "activity": "acetyl-CoA + N-terminal glycyl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetylglycyl-[protein].", "evidence": [ { "id": "Q4V8K3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8K3" } ] }, { "ec_number": "2.3.1.255", "activity": "", "evidence": [ { "id": "Q4V8K3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8K3" } ] } ] }, { "uniprot_ac": "Q9BSU3", "gene_name": "NAA11", "activity": [ { "ec_number": "2.3.1.255", "activity": "acetyl-CoA + N-terminal glycyl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetylglycyl-[protein].", "evidence": [ { "id": "Q9BSU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BSU3" } ] }, { "ec_number": "2.3.1.255", "activity": "", "evidence": [ { "id": "Q9BSU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BSU3" } ] } ] }, { "uniprot_ac": "Q9CQX6", "gene_name": "Naa12", "activity": [ { "ec_number": "2.3.1.255", "activity": "acetyl-CoA + N-terminal glycyl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetylglycyl-[protein].", "evidence": [ { "id": "Q9CQX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQX6" } ] }, { "ec_number": "2.3.1.255", "activity": "", "evidence": [ { "id": "Q9CQX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQX6" } ] } ] }, { "uniprot_ac": "Q9QY36", "gene_name": "Naa10", "activity": [ { "ec_number": "2.3.1.255", "activity": "acetyl-CoA + N-terminal glycyl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetylglycyl-[protein].", "evidence": [ { "id": "Q9QY36", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QY36" } ] }, { "ec_number": "2.3.1.255", "activity": "", "evidence": [ { "id": "Q9QY36", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QY36" } ] } ] }, { "uniprot_ac": "Q9VT75", "gene_name": "vnc", "activity": [ { "ec_number": "2.3.1.255", "activity": "acetyl-CoA + N-terminal glycyl-[protein] = CoA + H(+) + N-terminal N(alpha)-acetylglycyl-[protein].", "evidence": [ { "id": "Q9VT75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VT75" } ] }, { "ec_number": "2.3.1.255", "activity": "", "evidence": [ { "id": "Q9VT75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VT75" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ] }