{
    "uniprot_canonical_ac": "A0A0G2K2D0-1",
    "uniprot_ac": "A0A0G2K2D0",
    "uniprot_id": "A0A0G2K2D0_RAT",
    "mass": {
        "chemical_mass": 35607.0,
        "monoisotopic_mass": 35607.0
    },
    "refseq": {
        "ac": "NP_001000641",
        "name": "olfactory receptor Olr648",
        "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000641"
    },
    "gene_names": [
        {
            "name": "Olr648",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A0A0G2K2D0",
            "id": "A0A0G2K2D0"
        },
        {
            "name": "Olfr1192-ps1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/A0A0G2K2D0",
            "id": "A0A0G2K2D0"
        },
        {
            "name": "Olr648",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000641",
            "id": "NP_001000641"
        }
    ],
    "protein_names": [
        {
            "name": "Olfactory receptor",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A0A0G2K2D0#names_and_taxonomy",
            "id": "A0A0G2K2D0"
        },
        {
            "name": "olfactory receptor Olr648",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000641",
            "id": "NP_001000641"
        },
        {
            "name": "olfactory receptor gene Olr648",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000641",
            "id": "NP_001000641"
        }
    ],
    "function": [
        {
            "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001000641",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000641"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Rattus norvegicus",
            "taxid": 10116,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A0G2K2D0",
                    "url": "https://www.uniprot.org/uniprot/A0A0G2K2D0"
                }
            ],
            "common_name": "Rat"
        }
    ],
    "gene": [
        {
            "name": "Olr648",
            "url": "https://www.uniprot.org/uniprot/A0A0G2K2D0",
            "locus": {
                "chromosome": "3",
                "start_pos": 77047466,
                "end_pos": 77048401,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSRNOG00000059965",
                        "url": "https://www.ensembl.org/id/ENSRNOG00000059965"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "404834",
            "url": "https://www.ncbi.nlm.nih.gov/gene/404834",
            "database": "GeneID"
        },
        {
            "id": "IPR000276",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276",
            "database": "InterPro"
        },
        {
            "id": "IPR000725",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725",
            "database": "InterPro"
        },
        {
            "id": "IPR017452",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452",
            "database": "InterPro"
        },
        {
            "id": "rno:404834",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:404834",
            "database": "KEGG Pathway"
        },
        {
            "id": "CTQLIHQ",
            "url": "https://omabrowser.org/oma/group/CTQLIHQ/",
            "database": "OMA"
        },
        {
            "id": "979289at2759",
            "url": "http://www.orthodb.org/?query=979289at2759",
            "database": "OrthoDB"
        },
        {
            "id": "PF13853",
            "url": "http://pfam.xfam.org/family/PF13853",
            "database": "Pfam"
        },
        {
            "id": "NP_001000641",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000641",
            "database": "RefSeq"
        },
        {
            "id": "1333456",
            "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1333456",
            "database": "RGD"
        },
        {
            "id": "A0A0G2K2D0",
            "url": "https://www.uniprot.org/uniprot/A0A0G2K2D0",
            "database": "UniProtKB"
        },
        {
            "id": "A0A0G2K2D0-1",
            "url": "https://www.uniprot.org/uniprot/A0A0G2K2D0-1",
            "database": "UniProtKB"
        }
    ],
    "sequence": {
        "sequence": "MDKSNNITVFILLGLSQNKNTEILCFVFFLFCYIAIWMGNVLIMISITGTQLIEQPMYFFLNYLSLSDLCYTSTVTPKLMTDLLAERKVISYNNCMIQLFTTHLFGGIEIFILTGMAYDRYVAICRPLHYTVIMSRHRCNLIIITCCTGGFVHSACQLFLTIFLPFCGPNEIDHYFCDVYPLLKLACSNTHIIGLLVIANSGLIALVTFVVLIFSYFFILYTVRAFSAESRSKALSTCSSHLTIVVLFFAPALFIYIRPATTFPEDKVFAPFYTIIAPMFNPLIYTLRNTEMKNALRKVWGHQGLLKGLSQKN",
        "length": 313,
        "header": "tr|A0A0G2K2D0-1|A0A0G2K2D0_RAT Isoform 1 of Olfactory receptor  OS=Rattus norvegicus OX=10116 GN=Olr648 PE=3 SV=2 CANONICAL=A0A0G2K2D0-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A0G2K2D0-1",
            "url": "https://www.uniprot.org/uniprot/A0A0G2K2D0#A0A0G2K2D0-1",
            "sequence": {
                "sequence": "MDKSNNITVFILLGLSQNKNTEILCFVFFLFCYIAIWMGNVLIMISITGTQLIEQPMYFFLNYLSLSDLCYTSTVTPKLMTDLLAERKVISYNNCMIQLFTTHLFGGIEIFILTGMAYDRYVAICRPLHYTVIMSRHRCNLIIITCCTGGFVHSACQLFLTIFLPFCGPNEIDHYFCDVYPLLKLACSNTHIIGLLVIANSGLIALVTFVVLIFSYFFILYTVRAFSAESRSKALSTCSSHLTIVVLFFAPALFIYIRPATTFPEDKVFAPFYTIIAPMFNPLIYTLRNTEMKNALRKVWGHQGLLKGLSQKN",
                "length": 313,
                "header": "tr|A0A0G2K2D0-1|A0A0G2K2D0_RAT Isoform 1 of Olfactory receptor  OS=Rattus norvegicus OX=10116 GN=Olr648 PE=3 SV=2 CANONICAL=A0A0G2K2D0-1"
            },
            "locus": {
                "chromosome": "3",
                "start_pos": 74356991,
                "end_pos": 74352550,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSRNOT00000089424.2",
                        "url": "https://www.ensembl.org/id/ENSRNOT00000089424.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSRNOP00000072193.2",
                        "url": "https://www.ensembl.org/id/ENSRNOP00000072193.2"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.",
            "journal": "Briefings in bioinformatics",
            "date": "2011",
            "authors": "Gaudet P, Livstone MS, Lewis SE, Thomas PD",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001000641",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001000641"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21873635",
                    "url": "https://glygen.org/publication/PubMed/21873635"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "rno:404834",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:404834",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q8NGL7-1",
            "protein_name": "Olfactory receptor 4P4",
            "gene_name": "OR4P4",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MEKSNNSTLFILLGFSQNKNIEVLCFVLFLFCYIAIWMGNLLIMISITCTQLIHQPMYFFLNYLSLSDLCYTSTVTPKLMVDLLAERKTISYNNCMIQLFTTHFFGGIEIFILTGMAYDRYVAICKPLHYTIIMSRQKCNTIIIVCCTGGFIHSASQFLLTIFVPFCGPNEIDHYFCDVYPLLKLACSNIHMIGLLVIANSGLIALVTFVVLLLSYVFILYTIRAYSAERRSKALATCSSHVIVVVLFFAPALFIYIRPVTTFSEDKVFALFYTIIAPMFNPLIYTLRNTEMKNAMRKVWCCQILLKRNQLF",
                "length": 312
            },
            "evidence": [
                {
                    "id": "41504926",
                    "url": "http://www.informatics.jax.org/homology/41504926",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor activity",
                        "id": "GO:0004930",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A0G2K2D0",
                                "url": "https://www.uniprot.org/uniprot/A0A0G2K2D0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "olfactory receptor activity",
                        "id": "GO:0004984",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A0G2K2D0",
                                "url": "https://www.uniprot.org/uniprot/A0A0G2K2D0"
                            }
                        ],
                        "pmid": "21873635"
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "integral component of plasma membrane",
                        "id": "GO:0005887",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005887",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A0A0G2K2D0",
                                "url": "https://www.uniprot.org/uniprot/A0A0G2K2D0"
                            }
                        ],
                        "pmid": "21873635"
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 6,
            "end_pos": 8,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ]
}