{ "uniprot_canonical_ac": "A4UUI3-1", "uniprot_ac": "A4UUI3", "uniprot_id": "A4UUI3_MOUSE", "mass": { "chemical_mass": 72042.0, "monoisotopic_mass": 72042.0 }, "refseq": { "ac": "NP_001242934", "name": "macrophage activation 2 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934" }, "gene_names": [ { "name": "Gbp4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3" }, { "name": "AW228052; Mag-2; Mpa-2; Mpa2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934", "id": "NP_001242934" }, { "name": "Gbp4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934", "id": "NP_001242934" } ], "protein_names": [ { "name": "Guanylate binding protein 4.1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A4UUI3#names_and_taxonomy", "id": "A4UUI3" }, { "name": "Guanylate-binding protein 4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A4UUI3#names_and_taxonomy", "id": "A4UUI3" }, { "name": "guanylate-binding protein 4 homolog; guanylate nucleotide binding protein 4; macrophage activation 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934", "id": "NP_001242934" }, { "name": "macrophage activation 2 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934", "id": "NP_001242934" } ], "function": [ { "annotation": "GBP4 is a negative regulator of virus-triggered type I interferon (IFN-I) production, interacting as a novel protein targeting interferon regulatory factor (IRF)-7 and inhibiting its function.", "evidence": [ { "database": "RefSeq", "id": "NP_001242934", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934" }, { "database": "PubMed", "id": "22095711", "url": "https://glygen.org/publication/PubMed/22095711" } ] }, { "annotation": "Two splice variants of mGBP4 could be detected. One variant led to a premature stop codon after 312 bp. The second variant resulted in a transcript with a disrupted G2 domain.", "evidence": [ { "database": "RefSeq", "id": "NP_001242934", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934" }, { "database": "PubMed", "id": "17919070", "url": "https://glygen.org/publication/PubMed/17919070" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gbp4", "url": "https://www.uniprot.org/uniprot/A4UUI3", "locus": { "chromosome": "5", "start_pos": 105139586, "end_pos": 105115767, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000079363", "url": "https://www.ensembl.org/id/ENSMUSG00000079363" } ] } } ], "crossref": [ { "id": "ENSMUSG00000079363", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000079363", "database": "Bgee" }, { "id": "cd16269", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16269", "database": "CDD" }, { "id": "17472", "url": "https://www.ncbi.nlm.nih.gov/gene/17472", "database": "GeneID" }, { "id": "IPR003191", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003191", "database": "InterPro" }, { "id": "IPR015894", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015894", "database": "InterPro" }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro" }, { "id": "IPR030386", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030386", "database": "InterPro" }, { "id": "IPR036543", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036543", "database": "InterPro" }, { "id": "IPR037684", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037684", "database": "InterPro" }, { "id": "mmu:17472", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:17472", "database": "KEGG Pathway" }, { "id": "97072", "url": "http://www.informatics.jax.org/marker/MGI:97072", "database": "MGI" }, { "id": "QELMEVH", "url": "https://omabrowser.org/oma/group/QELMEVH/", "database": "OMA" }, { "id": "1027269at2759", "url": "http://www.orthodb.org/?query=1027269at2759", "database": "OrthoDB" }, { "id": "PF02263", "url": "http://pfam.xfam.org/family/PF02263", "database": "Pfam" }, { "id": "PF02841", "url": "http://pfam.xfam.org/family/PF02841", "database": "Pfam" }, { "id": "NP_001242934", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934", "database": "RefSeq" }, { "id": "19669", "url": "https://www.rhea-db.org/rhea/19669", "database": "Rhea" }, { "id": "A0A0G2JDT5", "url": "https://www.uniprot.org/uniprot/A0A0G2JDT5", "database": "UniProtKB" }, { "id": "A0A0G2JDT5-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JDT5-1", "database": "UniProtKB" }, { "id": "A0A0G2JEJ5", "url": "https://www.uniprot.org/uniprot/A0A0G2JEJ5", "database": "UniProtKB" }, { "id": "A0A0G2JEJ5-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JEJ5-1", "database": "UniProtKB" }, { "id": "A0A0G2JGT4", "url": "https://www.uniprot.org/uniprot/A0A0G2JGT4", "database": "UniProtKB" }, { "id": "A0A0G2JGT4-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JGT4-1", "database": "UniProtKB" }, { "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3", "database": "UniProtKB" }, { "id": "A4UUI3-1", "url": "https://www.uniprot.org/uniprot/A4UUI3-1", "database": "UniProtKB" }, { "id": "A4UUI4", "url": "https://www.uniprot.org/uniprot/A4UUI4", "database": "UniProtKB" }, { "id": "A4UUI4-1", "url": "https://www.uniprot.org/uniprot/A4UUI4-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGWSHTGKSYLMNCLAGQNHVSGTLPTSQRFPSGLHRAVSDQGHLDVVHAPPHQARALVLLDTEGLGDVEKGDPKNDLWIFALSVLLSSTFVYNSMNTINHQALEQLHYVTELTELIRAKSSPNPHGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDEYLENALKLIPGNNPRIQASNSARECIRRFFPNRKCFVFEWPTHDIELIKQLETISEDQLDPTFKESAMAFASYIFTYAKIKTLREGIKVTGNGLGTLVTTYVDAINSGAVPCLDDAVTTLAQRENSVAVQKAASHYSEQMAQRLSLPTDTIQELLDVHAACEKEAMAVFMEHSFKDENQQFLKKLVELLREKNGLFLLKNEEASDKYCQEELDRLSKDLMDNISTFSVPGGHRLYMDMREKIEHDYWQVPRKGVKASEVFQNFLQSQAIIESSILQADTALTAGQKAIAEKHTKKEAAEKEQDLLRQKQKEHQEYMEAQEKRNKENLEQLRRKLEQEREQLIKDHNMMLEKLTKEQKTFREEGYKTQAEELRREIHQLGHNIKEMKQNGDSLVESILRSWFSFISPPSESEKAISSVLSLLRKKDRL", "length": 631, "header": "tr|A4UUI3-1|A4UUI3_MOUSE Isoform 1 of Guanylate-binding protein 4 OS=Mus musculus OX=10090 GN=Gbp4 PE=1 SV=1 CANONICAL=A4UUI3-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JDT5-1", "url": "https://www.uniprot.org/uniprot/A4UUI3#A0A0G2JDT5-1", "sequence": { "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGWSHTGKSYLMNCLAGQNHVSGTLPTSQRFPSGLHRAVSDQGHLDVVHAPPHQARALVLLDTEGLGDVEKGDPKNDLWIFALSVLLSSTFVYNSMNTINHQALEQLHYVTELTELIRAKSSPNPHGIKNSTEFVSFFPDFVW", "length": 184, "header": "tr|A0A0G2JDT5-1|A0A0G2JDT5_MOUSE Computationally mapped isoform of Guanylate-binding protein 4 OS=Mus musculus OX=10090 GN=Gbp4 PE=3 SV=1 CANONICAL=A4UUI3-1" }, "locus": { "chromosome": "5", "start_pos": 105284887, "end_pos": 105273092, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000197799", "url": "https://www.ensembl.org/id/ENSMUST00000197799" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000142493", "url": "https://www.ensembl.org/id/ENSMUSP00000142493" } ] } }, { "isoform_ac": "A0A0G2JEJ5-1", "url": "https://www.uniprot.org/uniprot/A4UUI3#A0A0G2JEJ5-1", "sequence": { "sequence": "MNTINHQALEQLHYVTELTELIRAKSSPNPHGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDEYLENALKLIPGNNPRIQASNSARECIRRFFPNRKCFVFEWPTHDIELIKQLETISEDQLDPTFKESAMAFASYIFTYAKIK", "length": 149, "header": "tr|A0A0G2JEJ5-1|A0A0G2JEJ5_MOUSE Computationally mapped isoform of Guanylate-binding protein 4 OS=Mus musculus OX=10090 GN=Gbp4 PE=1 SV=1 CANONICAL=A4UUI3-1" }, "locus": { "chromosome": "5", "start_pos": 105273420, "end_pos": 105270775, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000196677", "url": "https://www.ensembl.org/id/ENSMUST00000196677" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000142795", "url": "https://www.ensembl.org/id/ENSMUSP00000142795" } ] } }, { "isoform_ac": "A0A0G2JGT4-1", "url": "https://www.uniprot.org/uniprot/A4UUI3#A0A0G2JGT4-1", "sequence": { "sequence": "MNTINHQALEQLHYVTELTELIRAKSSPNPHGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDEYLENALKLIPGNNPRIQASNSARECIRRFFPNRKCFVFEWPTHDIELIKQLETISEDQL", "length": 127, "header": "tr|A0A0G2JGT4-1|A0A0G2JGT4_MOUSE Computationally mapped isoform of Guanylate-binding protein 4 OS=Mus musculus OX=10090 GN=Gbp4 PE=1 SV=1 CANONICAL=A4UUI3-1" }, "locus": { "chromosome": "5", "start_pos": 105273420, "end_pos": 105270841, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000199629", "url": "https://www.ensembl.org/id/ENSMUST00000199629" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000143689", "url": "https://www.ensembl.org/id/ENSMUSP00000143689" } ] } }, { "isoform_ac": "A4UUI3-1", "url": "https://www.uniprot.org/uniprot/A4UUI3#A4UUI3-1", "sequence": { "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGWSHTGKSYLMNCLAGQNHVSGTLPTSQRFPSGLHRAVSDQGHLDVVHAPPHQARALVLLDTEGLGDVEKGDPKNDLWIFALSVLLSSTFVYNSMNTINHQALEQLHYVTELTELIRAKSSPNPHGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDEYLENALKLIPGNNPRIQASNSARECIRRFFPNRKCFVFEWPTHDIELIKQLETISEDQLDPTFKESAMAFASYIFTYAKIKTLREGIKVTGNGLGTLVTTYVDAINSGAVPCLDDAVTTLAQRENSVAVQKAASHYSEQMAQRLSLPTDTIQELLDVHAACEKEAMAVFMEHSFKDENQQFLKKLVELLREKNGLFLLKNEEASDKYCQEELDRLSKDLMDNISTFSVPGGHRLYMDMREKIEHDYWQVPRKGVKASEVFQNFLQSQAIIESSILQADTALTAGQKAIAEKHTKKEAAEKEQDLLRQKQKEHQEYMEAQEKRNKENLEQLRRKLEQEREQLIKDHNMMLEKLTKEQKTFREEGYKTQAEELRREIHQLGHNIKEMKQNGDSLVESILRSWFSFISPPSESEKAISSVLSLLRKKDRL", "length": 631, "header": "tr|A4UUI3-1|A4UUI3_MOUSE Isoform 1 of Guanylate-binding protein 4 OS=Mus musculus OX=10090 GN=Gbp4 PE=1 SV=1 CANONICAL=A4UUI3-1" }, "locus": { "chromosome": "5", "start_pos": 105284887, "end_pos": 105266147, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000100962", "url": "https://www.ensembl.org/id/ENSMUST00000100962" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000098522", "url": "https://www.ensembl.org/id/ENSMUSP00000098522" } ] } }, { "isoform_ac": "A4UUI4-1", "url": "https://www.uniprot.org/uniprot/A4UUI3#A4UUI4-1", "sequence": { "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGWSHTGKSYLMNCLAGQNHVSLWAPPCSLRPRASGCGACPTPPSQSTGPPGHRGPGRCGKG", "length": 103, "header": "tr|A4UUI4-1|A4UUI3_MOUSE Computationally mapped isoform of Guanylate-binding protein 4 OS=Mus musculus OX=10090 GN=Gbp4 PE=1 SV=1 CANONICAL=A4UUI3-1" }, "locus": { "chromosome": "5", "start_pos": 105284887, "end_pos": 105273491, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000196204", "url": "https://www.ensembl.org/id/ENSMUST00000196204" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000142528", "url": "https://www.ensembl.org/id/ENSMUSP00000142528" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "In silico and in vitro characterization of mGBP4 splice variants.", "journal": "DNA and cell biology", "date": "2007", "authors": "Konermann C, Kresse A, Beuter-Gunia C, Wurthner J, Degrandi D, Pfeffer K, Beer S", "evidence": [ { "database": "RefSeq", "id": "NP_001242934", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934" } ], "reference": [ { "type": "PubMed", "id": "17919070", "url": "https://glygen.org/publication/PubMed/17919070" } ] }, { "title": "Extensive characterization of IFN-induced GTPases mGBP1 to mGBP10 involved in host defense.", "journal": "J. Immunol.", "date": "2007", "authors": "Pfeffer K., Beer S., Konermann C., Beuter-Gunia C., Degrandi D., Wurthner J., Kresse A., Kurig S.", "evidence": [ { "database": "UniProtKB", "id": "A4UUI4", "url": "https://www.uniprot.org/uniprot/A4UUI4" }, { "database": "UniProtKB", "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ], "reference": [ { "type": "PubMed", "id": "18025219", "url": "https://glygen.org/publication/PubMed/18025219" } ] }, { "title": "Guanylate binding protein 4 negatively regulates virus-induced type I IFN and antiviral response by targeting IFN regulatory factor 7.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2011", "authors": "Hu Y, Wang J, Yang B, Zheng N, Qin M, Ji Y, Lin G, Tian L, Wu X, Wu L, Sun B", "evidence": [ { "database": "RefSeq", "id": "NP_001242934", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934" } ], "reference": [ { "type": "PubMed", "id": "22095711", "url": "https://glygen.org/publication/PubMed/22095711" } ] } ], "pathway": [ { "id": "mmu:17472", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:17472", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2JDV3-1", "protein_name": "Guanylate-binding protein 6", "gene_name": "Gbp6", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGLYRTGKSYLMNCLAGQNHGFPLGSTVQSQTKGIWMWCMPHPTKPEHTLVLLDTEGLGDVEKGDPKNDLWIFALSVLLSSTFIYNSMITINHQALEQLHYVTELTELIRAKSSPNPAGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDDYLENALKLIPGDKPRMQASNSCRECIRLFFPNRKCFVFDRPTHDKELLQKLDSITEDQLDPKFQEVTKAFVSYIFTYAKIKTLKEGIKVTGNRLGILVTTYVNAINSGAVPCLDDAVTTLAQRENSVAVQKAADHYSEQMAQRLRLPTETLQELLDVHAACEKEAMAVFMEHSFKDENQQFLKKLVELIGENKELFLSKNEEASNKYCQEELDRLSKDFMENISTFFVPCGHKLYMDKREKIEHDYWQVPRKGVKASEVFQSFLQSQAFIESSILQADTALTAGEKAIAEERAQKVAAEKEQELLRQKQKEQQEYMEAQEKSHKENLEQLRRKLEQEREQDIKDHDMMLKKLMKDQKAFLEEGFKKKAEEMNKEIQQLRDVIKDKKRNTDRIKEALLNGFSTVLFHYLVRYLKHL", "length": 611 }, "evidence": [ { "id": "128731", "url": "http://www.informatics.jax.org/homology/128731", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "M0RDF8-1", "protein_name": "Guanylate-binding protein family member 6", "gene_name": "Gbp6", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "VTQPQMAPICLVENHNERLSVNQKAIEILDKISQPVVVVAIVGLYRTGKSYLMNCLAGQNHSGMLGTSQRLPSGLYSAVADQGHLDVVRATPHQAKALVLLDTEGLGDVEKGDPKNDSWIFALAVLLSSTFVYNSLSTINHQALEQLYYVTELTKLIRARSSPNPDGIKNSTEFVSFFPDFVWTVRDFMLELTLNGKNITSDEYLENALKLIPGNSPRIQASNLPRECIRQFFPNRKCFVFDRPTHDKELLQKLETISEDQLDPNFREGTKAFVSYIFTYAKMKTLREGIKVTGNRLGTLVTTYVDAINSGAVPCLDDAVTTLAQRENSVAVQKAVDHYSEQMAQRLRLPTDTLQELLDEHTACEKEAISVFMEHSFKDENQLFLKKLVKLIGEKKGLFVLKNEEASDKYCQEELDRLSKDFMENISTFSVPGGHRLYVDMREKIERDYWQVPRKGVKASEVFQSFLQSQVIIESSILQADTALTAGEKAIAEERTQREAAEKEQELLRQKQREQQQLMEAQEKSNKENLEQLREKLVQERKQLIEEHNMMLEKQLKDQKAYLEE", "length": 565 }, "evidence": [ { "id": "A4UUI3", "url": "https://omabrowser.org/oma/group/A4UUI3/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q000W5-1", "protein_name": "Guanylate-binding protein 10", "gene_name": "Gbp10", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGWSRTGKSYLMNCLAGQNHGFPLGSTVQSQTKGIWMWCMPHPTKPEHTLVLLDTEGLGDVEKGDPKNDLWIFALSVLLSSTFIYNSMITINHQALEQLHYVTELTELIRAKSSPNPAGIKNSTEFVSFFPDFVWIVRDFMLELKLNGEDITSDDYLENALKLIPGDKPRMQASNSCRECIRLFFPNRKCFVFDRPTHDKELLQKLDSITEDQLDPKFQEVTKAFVSYIFTYAKIKTLKEGIKVTGNKLGILVTTYVDAINSGAVPCLDDAVTTLAQRENSVAVQKAADHYSEQMAQRLRLPTETLQELLDVHAACEKEAMAVFMEHSFKDENQQFLKKLVELIGENKELFLSKNEEASNKYCQEELDRLSKDFMENISTFFVPCGHKLYMDKREKIEHDYWQVPRKGVKASEVFQSFLQSQAFIESSILQADTALTAGKKAIAEERAQKVAAEKEQDLLRQKQKEQQEYMEAQEKSHKENIEQLRRKLMQEREQLIKDHNMMLKKQLKDQKAFLEEGFKKKAEEMNKEIQQLRDVIKDKKRNTDRIKDALLNGFSTVLFHYLVRYLKHL", "length": 611 }, "evidence": [ { "id": "128731", "url": "http://www.informatics.jax.org/homology/128731", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q6ZN66-1", "protein_name": "Guanylate-binding protein 6", "gene_name": "GBP6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MESGPKMLAPVCLVENNNEQLLVNQQAIQILEKISQPVVVVAIVGLYRTGKSYLMNHLAGQNHGFPLGSTVQSETKGIWMWCVPHPSKPNHTLVLLDTEGLGDVEKGDPKNDSWIFALAVLLCSTFVYNSMSTINHQALEQLHYVTELTELIKAKSSPRPDGVEDSTEFVSFFPDFLWTVRDFTLELKLNGHPITEDEYLENALKLIQGNNPRVQTSNFPRECIRRFFPKRKCFVFDRPTNDKDLLANIEKVSEKQLDPKFQEQTNIFCSYIFTHARTKTLREGITVTGNRLGTLAVTYVEAINSGAVPCLENAVITLAQRENSAAVQRAADYYSQQMAQRVKLPTDTLQELLDMHAACEREAIAIFMEHSFKDENQEFQKKFMETTMNKKGDFLLQNEESSVQYCQAKLNELSKGLMESISAGSFSVPGGHKLYMETKERIEQDYWQVPRKGVKAKEVFQRFLESQMVIEESILQSDKALTDREKAVAVDRAKKEAAEKEQELLKQKLQEQQQQMEAQDKSRKENIAQLKEKLQMEREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGVSSLFKKHKLPF", "length": 633 }, "evidence": [ { "id": "128731", "url": "http://www.informatics.jax.org/homology/128731", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8BTS3-1", "protein_name": "Guanylate-binding protein 9", "gene_name": "Gbp9", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTQPQMAPICLVENHNEQLLVNQEAIEILEKISQPVVVVAIVGLYRTGKSYLMNCLAGQNHGFPLGSTVQSQTKGIWMWCMPHPTKPEHTLVLLDTEGLGDVEKSNPKNDSWIFALSVLLSSTFVYNSMSTINHQALEQLHYVTELTELIRSKSSRNPHGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDEYLENALKLIPGYNPRVQASNSARECIRCFFPNRKCFVFDRPTHDRELLQKLETISEDQLDLKFREGTKAFVSYVFTYAKIKTLREGIKVTGNRLGTLVTTYVDAINSGAVPCLDDAMTSVARRENSVAVQKAADHYSEQMAQRLRLPTDTLQELLDVHAACEKEAMAVFMEHSFKDENQQFLKKLVEIISEKIAFFWLKNEEASNKYCQEELDRLSKDFMDNISTFSVPGGHRIYTDMRKKIERDYWQVPRKGVKACEVFQNFLQSQYIIESSILQADRALTAGEKAIAEERAQKEVAEKEQELLRQKQKEQQEYMEAQEKRNKENLEQLRRKLMQEREQDIKDHDMMLEKQLKDQKAFLEEGFTNKAEEINAEIERLEHNIKDKKENIGPILELIEKAFCAGVFSSLIMVALLTHNPSLLRK", "length": 619 }, "evidence": [ { "id": "128731", "url": "http://www.informatics.jax.org/homology/128731", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ], "pmid": "22095711" }, { "name": "defense response to Gram-positive bacterium", "id": "GO:0050830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830", "evidence": [ { "database": "UniProtKB", "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ], "pmid": "21873635" }, { "name": "negative regulation of protein phosphorylation", "id": "GO:0001933", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001933", "evidence": [ { "database": "UniProtKB", "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ], "pmid": "22095711" }, { "name": "negative regulation of protein import into nucleus", "id": "GO:0042308", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042308", "evidence": [ { "database": "UniProtKB", "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ], "pmid": "22095711" }, { "name": "negative regulation of protein ubiquitination", "id": "GO:0031397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031397", "evidence": [ { "database": "UniProtKB", "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ], "pmid": "22095711" }, { "name": "cellular response to interferon-gamma", "id": "GO:0071346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071346", "evidence": [ { "database": "UniProtKB", "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ], "pmid": "18025219" }, { "name": "defense response to protozoan", "id": "GO:0042832", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042832", "evidence": [ { "database": "UniProtKB", "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ], "pmid": "21873635" }, { "name": "regulation of defense response to virus", "id": "GO:0050688", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050688", "evidence": [ { "database": "UniProtKB", "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ], "pmid": "22095711" }, { "name": "negative regulation of interferon-alpha production", "id": "GO:0032687", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032687", "evidence": [ { "database": "UniProtKB", "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ], "pmid": "22095711" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ], "pmid": "21873635" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ], "pmid": "21873635" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "A4UUI3", "url": "https://www.uniprot.org/uniprot/A4UUI3" } ], "pmid": "21873635" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 171, "end_pos": 173, "annotation": "n_glycosylation_sequon" }, { "start_pos": 426, "end_pos": 428, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "19669", "name": "", "equation": "GTP + H2O = GDP + H(+) + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61227-1", "P97538-1", "Q04970-1", "Q63486-1", "Q63487-1", "P20171-1", "Q8R4Z9-1", "P39052-1", "Q8CFN2-1", "Q6RUV5-1", "Q99P74-1", "Q63663-1", "Q8R500-1", "C9WPN6-1", "P21575-1", "B2GUV7-1", "O35303-1", "Q08877-1", "Q2TA68-1", "Q6AYF9-1", "P23640-1", "M0RC99-1", "O35509-1", "P61589-1", "D3ZHF8-1", "D3ZQL7-1", "Q6NYB7-1", "Q66HA6-1", "P63322-1", "Q6AYB5-1", "Q6IMA3-1", "P36860-1", "Q5BJQ5-1", "P62836-1", "Q6IMA7-1", "P09527-1", "P10536-1", "P05714-1", "P62494-1", "D3Z8L7-1", "P81795-1", "P08644-1", "P35281-1", "Q62636-1", "P51146-1", "P01112-1", "P10114-1", "P61225-1", "Q5VZM2-1", "Q96S79-1", "P11234-1", "P11233-1", "Q8IWA4-1", "Q05193-1", "O00429-1", "O60841-1", "O60313-1", "P60763-1", "P41091-1", "Q2VIR3-1", "P62834-1", "Q9H628-1", "Q6T310-1", "Q9UQ16-1", "P51159-1", "O95140-1", "Q9H0R5-1", "Q96PP8-1", "Q96PP9-1", "P32455-1", "Q8N442-1", "P50570-1", "Q6NXR0-1", "P20338-1", "P61018-1", "P51149-1", "P61020-1", "P63000-1", "P20339-1", "P32456-1", "P55039-1", "Q9Y295-1", "P60953-2", "P61586-1", "O00194-1", "Q7Z444-1", "Q92737-1", "Q9NYN1-1", "P62820-1", "Q92928-1", "Q9H0U4-1", "Q15907-1", "P62491-1", "Q9Y227-1", "Q9NQZ7-1", "O94811-1", "P51148-1", "Q9NVJ2-1", "Q5S007-1", "P01116-1", "Q96A58-1", "Q9NQL2-1", "P62070-1", "Q7L523-1", "Q9HB90-1", "Q9BPW5-1", "P61026-1", "P01111-1", "Q92963-1", "Q99578-1", "P61224-1", "P10301-1", "Q8IVH4-1", "O14807-1", "Q9Y3L5-1", "P61011-1", "P61226-1", "Q9JIW9-1", "Q61411-1", "Q8R367-1", "Q5SSG5-1", "P39053-1", "P39054-1", "Q8BZ98-1", "Q80U63-1", "Q05D44-1", "P63001-1", "Q9ERI2-1", "Q811U4-1", "O08989-1", "Q01514-1", "Q9Z0E6-1", "Q9QZ85-1", "Q61107-1", "Q8CFB4-1", "P58281-1", "Q8C3X4-1", "Q8C262-1", "Q62293-1", "P32233-1", "Q9QXB9-1", "Q5S006-1", "Q3T9E4-1", "Q7TQD2-1", "Q9QUI0-1", "P60766-2", "Q9CQD1-1", "Q99P58-1", "P62821-1", "P63321-1", "Q9CQW2-1", "Q8BU31-1", "Q99JI6-1", "Q9D1G1-1", "P56371-1", "P51150-1", "P61021-1", "P61027-1", "Q08AT1-1", "P10833-1", "Q922H7-1", "Q80ZJ1-1", "Q6NTA4-1", "P14576-1", "P70425-1", "P62071-1", "Q80X95-1", "Q8K5A4-1", "Q9Z0N2-1", "Q9Z0N1-1", "P60764-1", "Q8C7H1-1", "P08556-1", "P62835-1", "Q7TN89-1", "Q6IMB1-1", "Q8K1M6-1", "Q7TT45-1", "Q91ZR1-1", "P35278-1", "P46638-1", "P62492-1", "Q3TCT4-1", "Q99K70-1", "P70426-1", "P32883-1", "A1Z9N0-1", "P27619-1", "Q24208-1", "P04388-1", "P08645-1", "P08646-1", "P40793-1", "Q7KY04-1", "O96692-1", "O76901-1", "O18412-1", "P48555-1", "Q7YU24-1", "Q9VRH6-1", "Q9VQE0-1" ], "evidence": [ { "id": "19669", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19669" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A1Z9N0", "gene_name": "Opa1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "A1Z9N0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z9N0" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "A1Z9N0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1Z9N0" } ] } ] }, { "uniprot_ac": "B2GUV7", "gene_name": "Eif5b", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "B2GUV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GUV7" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "B2GUV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GUV7" } ] } ] }, { "uniprot_ac": "C9WPN6", "gene_name": "Eif2s3y", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "C9WPN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9WPN6" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "C9WPN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9WPN6" } ] } ] }, { "uniprot_ac": "D3Z8L7", "gene_name": "Rras", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "D3Z8L7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8L7" } ] } ] }, { "uniprot_ac": "D3ZHF8", "gene_name": "Guf1", "activity": [ { "ec_number": "3.6.5.n1", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "D3ZHF8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZHF8" } ] }, { "ec_number": "3.6.5.n1", "activity": "", "evidence": [ { "id": "D3ZHF8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZHF8" } ] } ] }, { "uniprot_ac": "D3ZQL7", "gene_name": "Tppp", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "D3ZQL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZQL7" } ] } ] }, { "uniprot_ac": "M0RC99", "gene_name": "Rab5a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "M0RC99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RC99" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "M0RC99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RC99" } ] } ] }, { "uniprot_ac": "O00194", "gene_name": "RAB27B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "O00194", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00194" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O00194", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00194" } ] } ] }, { "uniprot_ac": "O00429", "gene_name": "DNM1L", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "O00429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00429" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "O00429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00429" } ] } ] }, { "uniprot_ac": "O08989", "gene_name": "Mras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "O08989", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08989" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O08989", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08989" } ] } ] }, { "uniprot_ac": "O14807", "gene_name": "MRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "O14807", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14807" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O14807", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14807" } ] } ] }, { "uniprot_ac": "O18412", "gene_name": "fzo", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "O18412", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O18412" } ] } ] }, { "uniprot_ac": "O35303", "gene_name": "Dnm1l", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "O35303", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35303" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "O35303", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35303" } ] } ] }, { "uniprot_ac": "O35509", "gene_name": "Rab11b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "O35509", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35509" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O35509", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35509" } ] } ] }, { "uniprot_ac": "O60313", "gene_name": "OPA1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "O60313", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60313" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "O60313", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60313" } ] } ] }, { "uniprot_ac": "O60841", "gene_name": "EIF5B", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "O60841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60841" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "O60841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60841" } ] } ] }, { "uniprot_ac": "O76901", "gene_name": "Rab27", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "O76901", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76901" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O76901", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O76901" } ] } ] }, { "uniprot_ac": "O94811", "gene_name": "TPPP", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "O94811", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94811" } ] } ] }, { "uniprot_ac": "O95140", "gene_name": "MFN2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "O95140", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95140" } ] } ] }, { "uniprot_ac": "O96692", "gene_name": "Rap2l", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "O96692", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O96692" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "O96692", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O96692" } ] } ] }, { "uniprot_ac": "P01111", "gene_name": "NRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P01111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01111" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01111" } ] } ] }, { "uniprot_ac": "P01112", "gene_name": "HRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P01112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01112" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01112" } ] } ] }, { "uniprot_ac": "P01116", "gene_name": "KRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P01116", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01116" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01116", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01116" } ] } ] }, { "uniprot_ac": "P04388", "gene_name": "Ras64B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P04388", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04388" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P04388", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04388" } ] } ] }, { "uniprot_ac": "P05714", "gene_name": "Rab4a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P05714", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05714" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P05714", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05714" } ] } ] }, { "uniprot_ac": "P08556", "gene_name": "Nras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P08556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08556" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08556", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08556" } ] } ] }, { "uniprot_ac": "P08644", "gene_name": "Kras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P08644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08644" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08644", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08644" } ] } ] }, { "uniprot_ac": "P08645", "gene_name": "Rap1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P08645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08645" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08645", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08645" } ] } ] }, { "uniprot_ac": "P08646", "gene_name": "Ras85D", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P08646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08646" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P08646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08646" } ] } ] }, { "uniprot_ac": "P09527", "gene_name": "Rab7a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P09527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09527" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P09527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09527" } ] } ] }, { "uniprot_ac": "P10114", "gene_name": "RAP2A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P10114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10114" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P10114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10114" } ] } ] }, { "uniprot_ac": "P10301", "gene_name": "RRAS", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P10301", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10301" } ] } ] }, { "uniprot_ac": "P10536", "gene_name": "Rab1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P10536", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10536" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P10536", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10536" } ] } ] }, { "uniprot_ac": "P10833", "gene_name": "Rras", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P10833", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10833" } ] } ] }, { "uniprot_ac": "P11233", "gene_name": "RALA", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P11233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11233" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P11233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11233" } ] } ] }, { "uniprot_ac": "P11234", "gene_name": "RALB", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P11234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11234" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P11234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11234" } ] } ] }, { "uniprot_ac": "P14576", "gene_name": "Srp54", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P14576", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14576" } ] } ] }, { "uniprot_ac": "P20171", "gene_name": "Hras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P20171", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20171" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P20171", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20171" } ] } ] }, { "uniprot_ac": "P20338", "gene_name": "RAB4A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P20338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20338" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P20338", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20338" } ] } ] }, { "uniprot_ac": "P20339", "gene_name": "RAB5A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P20339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20339" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P20339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20339" } ] } ] }, { "uniprot_ac": "P21575", "gene_name": "Dnm1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P21575", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21575" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P21575", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21575" } ] } ] }, { "uniprot_ac": "P23640", "gene_name": "Rab27a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P23640", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23640" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P23640", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23640" } ] } ] }, { "uniprot_ac": "P27619", "gene_name": "shi", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P27619", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27619" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P27619", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27619" } ] } ] }, { "uniprot_ac": "P32233", "gene_name": "Drg1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32233" } ] } ] }, { "uniprot_ac": "P32455", "gene_name": "GBP1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32455" } ] } ] }, { "uniprot_ac": "P32456", "gene_name": "GBP2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P32456", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32456" } ] } ] }, { "uniprot_ac": "P32883", "gene_name": "Kras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P32883", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32883" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P32883", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32883" } ] } ] }, { "uniprot_ac": "P35278", "gene_name": "Rab5c", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P35278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35278" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P35278", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35278" } ] } ] }, { "uniprot_ac": "P35281", "gene_name": "Rab10", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P35281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35281" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P35281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35281" } ] } ] }, { "uniprot_ac": "P36860", "gene_name": "Ralb", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P36860", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36860" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P36860", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36860" } ] } ] }, { "uniprot_ac": "P39052", "gene_name": "Dnm2", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P39052", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39052" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P39052", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39052" } ] } ] }, { "uniprot_ac": "P39053", "gene_name": "Dnm1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P39053", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39053" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P39053", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39053" } ] } ] }, { "uniprot_ac": "P39054", "gene_name": "Dnm2", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P39054", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39054" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P39054", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39054" } ] } ] }, { "uniprot_ac": "P40793", "gene_name": "Cdc42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P40793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40793" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P40793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40793" } ] } ] }, { "uniprot_ac": "P41091", "gene_name": "EIF2S3", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P41091", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41091" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "P41091", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41091" } ] } ] }, { "uniprot_ac": "P46638", "gene_name": "Rab11b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P46638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46638" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P46638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46638" } ] } ] }, { "uniprot_ac": "P48555", "gene_name": "Rala", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P48555", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48555" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P48555", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48555" } ] } ] }, { "uniprot_ac": "P50570", "gene_name": "DNM2", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P50570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50570" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P50570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50570" } ] } ] }, { "uniprot_ac": "P51146", "gene_name": "Rab4b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P51146", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51146" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51146", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51146" } ] } ] }, { "uniprot_ac": "P51148", "gene_name": "RAB5C", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P51148", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51148" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51148", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51148" } ] } ] }, { "uniprot_ac": "P51149", "gene_name": "RAB7A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P51149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51149" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51149", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51149" } ] } ] }, { "uniprot_ac": "P51150", "gene_name": "Rab7a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P51150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51150" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51150" } ] } ] }, { "uniprot_ac": "P51159", "gene_name": "RAB27A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P51159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51159" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P51159", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51159" } ] } ] }, { "uniprot_ac": "P55039", "gene_name": "DRG2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P55039", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55039" } ] } ] }, { "uniprot_ac": "P56371", "gene_name": "Rab4a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P56371", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56371" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P56371", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56371" } ] } ] }, { "uniprot_ac": "P58281", "gene_name": "Opa1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P58281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58281" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "P58281", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58281" } ] } ] }, { "uniprot_ac": "P60763", "gene_name": "RAC3", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P60763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60763" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60763" } ] } ] }, { "uniprot_ac": "P60764", "gene_name": "Rac3", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P60764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60764" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60764", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60764" } ] } ] }, { "uniprot_ac": "P60766", "gene_name": "Cdc42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P60766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60766" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60766" } ] } ] }, { "uniprot_ac": "P60953", "gene_name": "CDC42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P60953", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60953" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P60953", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60953" } ] } ] }, { "uniprot_ac": "P61011", "gene_name": "SRP54", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P61011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61011" } ] } ] }, { "uniprot_ac": "P61018", "gene_name": "RAB4B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P61018", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61018" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61018", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61018" } ] } ] }, { "uniprot_ac": "P61020", "gene_name": "RAB5B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P61020", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61020" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61020", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61020" } ] } ] }, { "uniprot_ac": "P61021", "gene_name": "Rab5b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P61021", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61021" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61021", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61021" } ] } ] }, { "uniprot_ac": "P61026", "gene_name": "RAB10", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P61026", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61026" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61026", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61026" } ] } ] }, { "uniprot_ac": "P61027", "gene_name": "Rab10", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P61027", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61027" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61027", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61027" } ] } ] }, { "uniprot_ac": "P61224", "gene_name": "RAP1B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P61224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61224" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61224" } ] } ] }, { "uniprot_ac": "P61225", "gene_name": "RAP2B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P61225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61225" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61225" } ] } ] }, { "uniprot_ac": "P61226", "gene_name": "Rap2b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P61226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61226" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61226", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61226" } ] } ] }, { "uniprot_ac": "P61227", "gene_name": "Rap2b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P61227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61227" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61227" } ] } ] }, { "uniprot_ac": "P61586", "gene_name": "RHOA", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P61586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61586" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61586" } ] } ] }, { "uniprot_ac": "P61589", "gene_name": "Rhoa", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P61589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61589" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61589", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61589" } ] } ] }, { "uniprot_ac": "P62070", "gene_name": "RRAS2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62070", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62070" } ] } ] }, { "uniprot_ac": "P62071", "gene_name": "Rras2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P62071", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62071" } ] } ] }, { "uniprot_ac": "P62491", "gene_name": "RAB11A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P62491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62491" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62491" } ] } ] }, { "uniprot_ac": "P62492", "gene_name": "Rab11a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P62492", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62492" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62492", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62492" } ] } ] }, { "uniprot_ac": "P62494", "gene_name": "Rab11a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P62494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62494" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62494" } ] } ] }, { "uniprot_ac": "P62820", "gene_name": "RAB1A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P62820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62820" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62820", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62820" } ] } ] }, { "uniprot_ac": "P62821", "gene_name": "Rab1A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P62821", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62821" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62821", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62821" } ] } ] }, { "uniprot_ac": "P62834", "gene_name": "RAP1A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P62834", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62834" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62834", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62834" } ] } ] }, { "uniprot_ac": "P62835", "gene_name": "Rap1a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P62835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62835" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62835" } ] } ] }, { "uniprot_ac": "P62836", "gene_name": "Rap1a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P62836", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62836" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62836", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62836" } ] } ] }, { "uniprot_ac": "P63000", "gene_name": "RAC1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P63000", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63000" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63000", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63000" } ] } ] }, { "uniprot_ac": "P63001", "gene_name": "Rac1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P63001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63001" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63001", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63001" } ] } ] }, { "uniprot_ac": "P63321", "gene_name": "Rala", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P63321", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63321" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63321", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63321" } ] } ] }, { "uniprot_ac": "P63322", "gene_name": "Rala", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P63322", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63322" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P63322", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63322" } ] } ] }, { "uniprot_ac": "P70425", "gene_name": "Rit2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P70425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70425" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P70425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70425" } ] } ] }, { "uniprot_ac": "P70426", "gene_name": "Rit1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P70426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70426" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P70426", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70426" } ] } ] }, { "uniprot_ac": "P81795", "gene_name": "Eif2s3", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P81795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P81795" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "P81795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P81795" } ] } ] }, { "uniprot_ac": "P97538", "gene_name": "Mras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "P97538", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97538" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P97538", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97538" } ] } ] }, { "uniprot_ac": "Q01514", "gene_name": "Gbp1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q01514", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01514" } ] } ] }, { "uniprot_ac": "Q04970", "gene_name": "Nras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q04970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04970" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q04970", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04970" } ] } ] }, { "uniprot_ac": "Q05193", "gene_name": "DNM1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q05193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05193" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q05193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05193" } ] } ] }, { "uniprot_ac": "Q05D44", "gene_name": "Eif5b", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q05D44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05D44" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q05D44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05D44" } ] } ] }, { "uniprot_ac": "Q08877", "gene_name": "Dnm3", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q08877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08877" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q08877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08877" } ] } ] }, { "uniprot_ac": "Q08AT1", "gene_name": "Rasl12", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q08AT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08AT1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q08AT1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08AT1" } ] } ] }, { "uniprot_ac": "Q15907", "gene_name": "RAB11B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q15907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15907" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q15907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15907" } ] } ] }, { "uniprot_ac": "Q24208", "gene_name": "eIF2gamma", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q24208", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24208" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q24208", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q24208" } ] } ] }, { "uniprot_ac": "Q2TA68", "gene_name": "Opa1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q2TA68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TA68" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q2TA68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2TA68" } ] } ] }, { "uniprot_ac": "Q2VIR3", "gene_name": "EIF2S3B", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q2VIR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2VIR3" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q2VIR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2VIR3" } ] } ] }, { "uniprot_ac": "Q3T9E4", "gene_name": "Tgtp2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q3T9E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3T9E4" } ] } ] }, { "uniprot_ac": "Q3TCT4", "gene_name": "Entpd7", "activity": [ { "ec_number": "3.6.1.15", "activity": "NTP + H(2)O = NDP + phosphate.", "evidence": [ { "id": "Q3TCT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TCT4" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q3TCT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TCT4" } ] } ] }, { "uniprot_ac": "Q5BJQ5", "gene_name": "Rit2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q5BJQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BJQ5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q5BJQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BJQ5" } ] } ] }, { "uniprot_ac": "Q5S006", "gene_name": "Lrrk2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + a protein = ADP + a phosphoprotein.", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5S006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S006" } ] } ] }, { "uniprot_ac": "Q5S007", "gene_name": "LRRK2", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + a protein = ADP + a phosphoprotein.", "evidence": [ { "id": "Q5S007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S007" } ] }, { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5S007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S007" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q5S007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5S007" } ] } ] }, { "uniprot_ac": "Q5SSG5", "gene_name": "Rasl10b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q5SSG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SSG5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q5SSG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SSG5" } ] } ] }, { "uniprot_ac": "Q5VZM2", "gene_name": "RRAGB", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q5VZM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VZM2" } ] } ] }, { "uniprot_ac": "Q61107", "gene_name": "Gbp4", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q61107", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61107" } ] } ] }, { "uniprot_ac": "Q61411", "gene_name": "Hras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q61411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61411" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q61411", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61411" } ] } ] }, { "uniprot_ac": "Q62293", "gene_name": "Tgtp1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q62293", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62293" } ] } ] }, { "uniprot_ac": "Q62636", "gene_name": "Rap1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q62636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62636" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q62636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62636" } ] } ] }, { "uniprot_ac": "Q63486", "gene_name": "Rraga", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q63486", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63486" } ] } ] }, { "uniprot_ac": "Q63487", "gene_name": "RragB", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q63487", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63487" } ] } ] }, { "uniprot_ac": "Q63663", "gene_name": "Gbp2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q63663", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63663" } ] } ] }, { "uniprot_ac": "Q66HA6", "gene_name": "Arl8b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q66HA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HA6" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q66HA6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HA6" } ] } ] }, { "uniprot_ac": "Q6AYB5", "gene_name": "Srp54", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6AYB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYB5" } ] } ] }, { "uniprot_ac": "Q6AYF9", "gene_name": "Irgc", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6AYF9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AYF9" } ] } ] }, { "uniprot_ac": "Q6IMA3", "gene_name": "Rasl11a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q6IMA3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMA3" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6IMA3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMA3" } ] } ] }, { "uniprot_ac": "Q6IMA7", "gene_name": "Rasl11b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q6IMA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMA7" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6IMA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMA7" } ] } ] }, { "uniprot_ac": "Q6IMB1", "gene_name": "Rasl11a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q6IMB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMB1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6IMB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6IMB1" } ] } ] }, { "uniprot_ac": "Q6NTA4", "gene_name": "Rragb", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6NTA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NTA4" } ] } ] }, { "uniprot_ac": "Q6NXR0", "gene_name": "IRGC", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q6NXR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NXR0" } ] } ] }, { "uniprot_ac": "Q6NYB7", "gene_name": "Rab1A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q6NYB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NYB7" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6NYB7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NYB7" } ] } ] }, { "uniprot_ac": "Q6RUV5", "gene_name": "Rac1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q6RUV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6RUV5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6RUV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6RUV5" } ] } ] }, { "uniprot_ac": "Q6T310", "gene_name": "RASL11A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q6T310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6T310" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q6T310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6T310" } ] } ] }, { "uniprot_ac": "Q7KY04", "gene_name": "Rab4", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q7KY04", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KY04" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q7KY04", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KY04" } ] } ] }, { "uniprot_ac": "Q7L523", "gene_name": "RRAGA", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7L523", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7L523" } ] } ] }, { "uniprot_ac": "Q7TN89", "gene_name": "Eras", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q7TN89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TN89" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q7TN89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TN89" } ] } ] }, { "uniprot_ac": "Q7TQD2", "gene_name": "Tppp", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7TQD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TQD2" } ] } ] }, { "uniprot_ac": "Q7TT45", "gene_name": "Rragd", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7TT45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TT45" } ] } ] }, { "uniprot_ac": "Q7YU24", "gene_name": "Marf", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q7YU24", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7YU24" } ] } ] }, { "uniprot_ac": "Q7Z444", "gene_name": "ERAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q7Z444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z444" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q7Z444", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z444" } ] } ] }, { "uniprot_ac": "Q80U63", "gene_name": "Mfn2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q80U63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80U63" } ] } ] }, { "uniprot_ac": "Q80X95", "gene_name": "Rraga", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q80X95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X95" } ] } ] }, { "uniprot_ac": "Q80ZJ1", "gene_name": "Rap2a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q80ZJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZJ1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q80ZJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZJ1" } ] } ] }, { "uniprot_ac": "Q811U4", "gene_name": "Mfn1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q811U4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q811U4" } ] } ] }, { "uniprot_ac": "Q8BU31", "gene_name": "Rap2c", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q8BU31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BU31" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8BU31", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BU31" } ] } ] }, { "uniprot_ac": "Q8BZ98", "gene_name": "Dnm3", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q8BZ98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZ98" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q8BZ98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZ98" } ] } ] }, { "uniprot_ac": "Q8C262", "gene_name": "Irgc", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8C262", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C262" } ] } ] }, { "uniprot_ac": "Q8C3X4", "gene_name": "Guf1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8C3X4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C3X4" } ] } ] }, { "uniprot_ac": "Q8C7H1", "gene_name": "Mmaa", "activity": [ { "ec_number": "3.6.-.-", "activity": "", "evidence": [ { "id": "Q8C7H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C7H1" } ] } ] }, { "uniprot_ac": "Q8CFB4", "gene_name": "Gbp5", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8CFB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFB4" } ] } ] }, { "uniprot_ac": "Q8CFN2", "gene_name": "Cdc42", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q8CFN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFN2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8CFN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFN2" } ] } ] }, { "uniprot_ac": "Q8IVH4", "gene_name": "MMAA", "activity": [ { "ec_number": "3.6.-.-", "activity": "", "evidence": [ { "id": "Q8IVH4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IVH4" } ] } ] }, { "uniprot_ac": "Q8IWA4", "gene_name": "MFN1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8IWA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWA4" } ] } ] }, { "uniprot_ac": "Q8K1M6", "gene_name": "Dnm1l", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q8K1M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1M6" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q8K1M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1M6" } ] } ] }, { "uniprot_ac": "Q8K5A4", "gene_name": "Rasl10a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q8K5A4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K5A4" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8K5A4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K5A4" } ] } ] }, { "uniprot_ac": "Q8N442", "gene_name": "GUF1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8N442", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8N442" } ] } ] }, { "uniprot_ac": "Q8R367", "gene_name": "Rerg", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q8R367", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R367" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q8R367", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R367" } ] } ] }, { "uniprot_ac": "Q8R4Z9", "gene_name": "Mfn1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8R4Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4Z9" } ] } ] }, { "uniprot_ac": "Q8R500", "gene_name": "Mfn2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q8R500", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R500" } ] } ] }, { "uniprot_ac": "Q91ZR1", "gene_name": "Rab4b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q91ZR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZR1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q91ZR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZR1" } ] } ] }, { "uniprot_ac": "Q922H7", "gene_name": "Rasl11b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q922H7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922H7" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q922H7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922H7" } ] } ] }, { "uniprot_ac": "Q92737", "gene_name": "RASL10A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q92737", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92737" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q92737", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92737" } ] } ] }, { "uniprot_ac": "Q92928", "gene_name": "RAB1C", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q92928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92928" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q92928", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92928" } ] } ] }, { "uniprot_ac": "Q92963", "gene_name": "RIT1", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q92963", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92963" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q92963", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92963" } ] } ] }, { "uniprot_ac": "Q96A58", "gene_name": "RERG", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q96A58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96A58" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q96A58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96A58" } ] } ] }, { "uniprot_ac": "Q96PP8", "gene_name": "GBP5", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q96PP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PP8" } ] } ] }, { "uniprot_ac": "Q96PP9", "gene_name": "GBP4", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q96PP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PP9" } ] } ] }, { "uniprot_ac": "Q96S79", "gene_name": "RASL10B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q96S79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96S79" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q96S79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96S79" } ] } ] }, { "uniprot_ac": "Q99578", "gene_name": "RIT2", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q99578", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99578" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q99578", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99578" } ] } ] }, { "uniprot_ac": "Q99JI6", "gene_name": "Rap1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q99JI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JI6" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q99JI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JI6" } ] } ] }, { "uniprot_ac": "Q99K70", "gene_name": "Rragc", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q99K70", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99K70" } ] } ] }, { "uniprot_ac": "Q99P58", "gene_name": "Rab27b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q99P58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P58" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q99P58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P58" } ] } ] }, { "uniprot_ac": "Q99P74", "gene_name": "Rab27b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q99P74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P74" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q99P74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P74" } ] } ] }, { "uniprot_ac": "Q9BPW5", "gene_name": "RASL11B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9BPW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BPW5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9BPW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BPW5" } ] } ] }, { "uniprot_ac": "Q9CQD1", "gene_name": "Rab5a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9CQD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQD1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9CQD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQD1" } ] } ] }, { "uniprot_ac": "Q9CQW2", "gene_name": "Arl8b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9CQW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQW2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9CQW2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQW2" } ] } ] }, { "uniprot_ac": "Q9D1G1", "gene_name": "Rab1b", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9D1G1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1G1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9D1G1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1G1" } ] } ] }, { "uniprot_ac": "Q9ERI2", "gene_name": "Rab27a", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9ERI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERI2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9ERI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERI2" } ] } ] }, { "uniprot_ac": "Q9H0R5", "gene_name": "GBP3", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9H0R5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0R5" } ] } ] }, { "uniprot_ac": "Q9H0U4", "gene_name": "RAB1B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9H0U4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0U4" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9H0U4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H0U4" } ] } ] }, { "uniprot_ac": "Q9H628", "gene_name": "RERGL", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9H628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H628" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9H628", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H628" } ] } ] }, { "uniprot_ac": "Q9HB90", "gene_name": "RRAGC", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9HB90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HB90" } ] } ] }, { "uniprot_ac": "Q9JIW9", "gene_name": "Ralb", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9JIW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIW9" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9JIW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIW9" } ] } ] }, { "uniprot_ac": "Q9NQL2", "gene_name": "RRAGD", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9NQL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQL2" } ] } ] }, { "uniprot_ac": "Q9NQZ7", "gene_name": "ENTPD7", "activity": [ { "ec_number": "3.6.1.15", "activity": "NTP + H(2)O = NDP + phosphate.", "evidence": [ { "id": "Q9NQZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQZ7" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q9NQZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQZ7" } ] } ] }, { "uniprot_ac": "Q9NVJ2", "gene_name": "ARL8B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9NVJ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NVJ2" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9NVJ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NVJ2" } ] } ] }, { "uniprot_ac": "Q9NYN1", "gene_name": "RASL12", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9NYN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYN1" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9NYN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYN1" } ] } ] }, { "uniprot_ac": "Q9QUI0", "gene_name": "Rhoa", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9QUI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUI0" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9QUI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUI0" } ] } ] }, { "uniprot_ac": "Q9QXB9", "gene_name": "Drg2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9QXB9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXB9" } ] } ] }, { "uniprot_ac": "Q9QZ85", "gene_name": "Iigp1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9QZ85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZ85" } ] } ] }, { "uniprot_ac": "Q9UQ16", "gene_name": "DNM3", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9UQ16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQ16" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q9UQ16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQ16" } ] } ] }, { "uniprot_ac": "Q9VQE0", "gene_name": "Drp1", "activity": [ { "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9VQE0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VQE0" } ] }, { "ec_number": "3.6.5.5", "activity": "", "evidence": [ { "id": "Q9VQE0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VQE0" } ] } ] }, { "uniprot_ac": "Q9VRH6", "gene_name": "waw", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9VRH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VRH6" } ] } ] }, { "uniprot_ac": "Q9Y227", "gene_name": "ENTPD4", "activity": [ { "ec_number": "3.6.1.15", "activity": "NTP + H(2)O = NDP + phosphate.", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] }, { "ec_number": "3.6.1.6", "activity": "A nucleoside diphosphate + H(2)O = a nucleoside phosphate + phosphate.", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] }, { "ec_number": "3.6.1.42", "activity": "GDP + H(2)O = GMP + phosphate.", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] }, { "ec_number": "3.6.1.6", "activity": "", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] }, { "ec_number": "3.6.1.15", "activity": "", "evidence": [ { "id": "Q9Y227", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y227" } ] } ] }, { "uniprot_ac": "Q9Y295", "gene_name": "DRG1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9Y295", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y295" } ] } ] }, { "uniprot_ac": "Q9Y3L5", "gene_name": "RAP2C", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9Y3L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3L5" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "Q9Y3L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y3L5" } ] } ] }, { "uniprot_ac": "Q9Z0E6", "gene_name": "Gbp2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "Q9Z0E6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0E6" } ] } ] }, { "uniprot_ac": "Q9Z0N1", "gene_name": "Eif2s3x", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9Z0N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N1" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q9Z0N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N1" } ] } ] }, { "uniprot_ac": "Q9Z0N2", "gene_name": "Eif2s3y", "activity": [ { "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate.", "evidence": [ { "id": "Q9Z0N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N2" } ] }, { "ec_number": "3.6.5.3", "activity": "", "evidence": [ { "id": "Q9Z0N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z0N2" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ] }