{ "uniprot_canonical_ac": "A4GTP4-1", "uniprot_ac": "A4GTP4", "uniprot_id": "ELK1_RAT", "mass": { "chemical_mass": 45272.0, "monoisotopic_mass": 45272.0 }, "refseq": { "ac": "NP_001101529", "name": "ETS domain-containing protein Elk-1", "summary": "This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. Multiple isoforms are produced from this gene by the use of alternative translational start codons. [provided by RefSeq, Mar 2012].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529" }, "gene_names": [ { "name": "Elk1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4" }, { "name": "Elk1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529", "id": "NP_001101529" } ], "protein_names": [ { "name": "ETS domain-containing protein Elk-1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A4GTP4#names_and_taxonomy", "id": "A4GTP4" }, { "name": "ELK1, member of ETS oncogene family; ELK1, ETS transcription factor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529", "id": "NP_001101529" }, { "name": "ETS domain-containing protein Elk-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529", "id": "NP_001101529" } ], "function": [ { "annotation": "Elk1 suppression protects cortical neurons against oxygen-glucose deprivation injury. Erratum:[Exp Cell Res. 2018 Nov 1;372(1):83. PMID: 30266209]", "evidence": [ { "database": "RefSeq", "id": "NP_001101529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529" }, { "database": "PubMed", "id": "30053446", "url": "https://glygen.org/publication/PubMed/30053446" } ] }, { "annotation": "Insulin activates prolactin gene transcription by activating Elk-1 that recruits the NuA4 complex to the promoter.", "evidence": [ { "database": "RefSeq", "id": "NP_001101529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529" }, { "database": "PubMed", "id": "24075908", "url": "https://glygen.org/publication/PubMed/24075908" } ] }, { "annotation": "The CentA1-Ras-Elk-1 signaling pathway acts on mitochondria to regulate dendritic spine density and synaptic plasticity in response to Abeta in hippocampal neurons.", "evidence": [ { "database": "RefSeq", "id": "NP_001101529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529" }, { "database": "PubMed", "id": "23516302", "url": "https://glygen.org/publication/PubMed/23516302" } ] }, { "annotation": "This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. Multiple isoforms are produced from this gene by the use of alternative translational start codons. [provided by RefSeq, Mar 2012].", "evidence": [ { "database": "RefSeq", "id": "NP_001101529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529" } ] }, { "annotation": "Transcription factor that binds to purine-rich DNA sequences. Forms a ternary complex with SRF and the ETS and SRF motifs of the serum response element (SRE) on the promoter region of immediate early genes such as FOS and IER2 (By similarity) (PubMed:17156131). Induces target gene transcription upon JNK-signaling pathway stimulation (PubMed:17156131).", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4#function" }, { "database": "PubMed", "id": "17156131", "url": "https://glygen.org/publication/PubMed/17156131" }, { "database": "PubMed", "id": "P19419", "url": "https://glygen.org/publication/PubMed/P19419" } ] } ], "disease": [ { "disease_id": "DOID:10652", "recommended_name": { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer's disease", "description": "A tauopathy that is characterized by memory lapses, confusion, emotional instability and progressive loss of mental ability and results in progressive memory loss, impaired thinking, disorientation, and changes in personality and mood starting and leads in advanced cases to a profound decline in cognitive and physical functioning and is marked histologically by the degeneration of brain neurons especially in the cerebral cortex and by the presence of neurofibrillary tangles and plaques containing beta-amyloid." }, "synonyms": [ { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimer disease", "description": "" }, { "id": "DOID:10652", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10652", "name": "Alzheimers dementia", "description": "" } ], "evidence": [ { "id": "10652", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10652" } ] }, { "disease_id": "DOID:12217", "recommended_name": { "id": "DOID:12217", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12217", "name": "Lewy body dementia", "description": "A dementia that is characterized by the development of abnormal proteinaceous (alpha-synuclein) cytoplasmic inclusions, called Lewy bodies, throughout the brain that results in progressive decline in mental abilities." }, "synonyms": [ { "id": "DOID:12217", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12217", "name": "Dementia with Lewy bodies", "description": "" }, { "id": "DOID:12217", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12217", "name": "Diffuse Lewy body disease", "description": "" }, { "id": "DOID:12217", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12217", "name": "Lewy body disease", "description": "" }, { "id": "DOID:12217", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12217", "name": "Senile dementia of the Lewy body type", "description": "" }, { "id": "MONDO:0007488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007488", "name": "Lewy body dementia", "description": "A progressive form of dementia characterized by the presence of protein deposits called Lewy bodies in the midbrain and cerebral cortex, and loss of cholinergic and dopaminergic neurons. The signs and symptoms overlap with Alzheimer and Parkinson disease." }, { "id": "MONDO:0007488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007488", "name": "Lewy body disease", "description": "" }, { "id": "MONDO:0007488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007488", "name": "dementia, Lewy body; DLB", "description": "" }, { "id": "MONDO:0007488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007488", "name": "dementia, Lewy body", "description": "" }, { "id": "MONDO:0007488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007488", "name": "Lewy body dementia", "description": "" }, { "id": "MONDO:0007488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007488", "name": "diffuse Lewy body disease", "description": "" }, { "id": "MONDO:0007488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007488", "name": "diffuse Lewy body disease with gaze palsy", "description": "" }, { "id": "MONDO:0007488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007488", "name": "Lewy body variant of Alzheimer disease", "description": "" }, { "id": "MONDO:0007488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007488", "name": "DLB", "description": "" }, { "id": "MONDO:0007488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007488", "name": "dementia with Lewy bodies", "description": "" }, { "id": "MONDO:0007488", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007488", "name": "Senile dementia of the Lewy body type", "description": "" }, { "id": "MIM:127750", "resource": "MIM", "url": "https://www.omim.org/entry/127750", "name": "Dementia, Lewy body", "description": "Dementia, Lewy body" } ], "evidence": [ { "id": "12217", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12217" } ] }, { "disease_id": "DOID:12858", "recommended_name": { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "Huntington's disease", "description": "A neurodegenerative disease that has_material_basis_in autosomal dominant inheritance and is characterized by unwanted choreatic movements, behavioral and psychiatric disturbances and dementia and has_material_basis_in expansion of CAG triplet repeats (glutamine) resulting in neuron degeneration affecting muscle coordination, cognitive abilities." }, "synonyms": [ { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "HD", "description": "" }, { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "Huntington disease", "description": "" }, { "id": "DOID:12858", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:12858", "name": "Huntington's chorea", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington disease", "description": "Huntington disease (HD) is a rare neurodegenerative disorder of the central nervous system characterized by unwanted choreatic movements, behavioral and psychiatric disturbances and dementia." }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington's disease", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington's chorea", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "HD", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington disease", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington disease; HD", "description": "" }, { "id": "MONDO:0007739", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007739", "name": "Huntington chorea", "description": "" }, { "id": "MIM:143100", "resource": "MIM", "url": "https://www.omim.org/entry/143100", "name": "Huntington disease", "description": "Huntington disease" } ], "evidence": [ { "id": "12858", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:12858" } ] }, { "disease_id": "DOID:224", "recommended_name": { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "transient cerebral ischemia", "description": "A brain ischemia that is characterized by ischemia of brief duration and without resultant tissue death." }, "synonyms": [ { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "TIA", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "TIA - Transient ischaemic attack", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "TRANSIENT ISCHEMIC ATTACK", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "Transient cerebral ischaemia", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "Transient cerebral ischemia", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "Transient ischemic attacks", "description": "" }, { "id": "DOID:224", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:224", "name": "transient ischemic attack", "description": "" } ], "evidence": [ { "id": "224", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:224" } ] }, { "disease_id": "DOID:5419", "recommended_name": { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia", "description": "A psychotic disorder that is characterized by a disintegration of thought processes and of emotional responsiveness." }, "synonyms": [ { "id": "DOID:5419", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5419", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia (disease)", "description": "A major psychotic disorder characterized by abnormalities in the perception or expression of reality. It affects the cognitive and psychomotor functions. Common clinical signs and symptoms include delusions, hallucinations, disorganized thinking, and retreat from reality." }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia with or without an affective disorder", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia-1", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "SCZD", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizophrenia; SCZD", "description": "" }, { "id": "MONDO:0005090", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005090", "name": "schizoaffective disorder", "description": "" }, { "id": "MIM:181500", "resource": "MIM", "url": "https://www.omim.org/entry/181500", "name": "Schizophrenia", "description": "Schizophrenia" } ], "evidence": [ { "id": "5419", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5419" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "common_name": "Rat" } ], "gene": [ { "name": "Elk1", "url": "https://www.uniprot.org/uniprot/A4GTP4", "locus": { "chromosome": "X", "start_pos": 1297099, "end_pos": 1304822, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000010171", "url": "https://www.ensembl.org/id/ENSRNOG00000010171" } ] } } ], "crossref": [ { "id": "ENSRNOG00000010171", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000010171", "database": "Bgee" }, { "id": "314436", "url": "https://www.ncbi.nlm.nih.gov/gene/314436", "database": "GeneID" }, { "id": "IPR000418", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000418", "database": "InterPro" }, { "id": "IPR036388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388", "database": "InterPro" }, { "id": "IPR036390", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "database": "InterPro" }, { "id": "rno:314436", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:314436", "database": "KEGG Pathway" }, { "id": "NTAQVCG", "url": "https://omabrowser.org/oma/group/NTAQVCG/", "database": "OMA" }, { "id": "981551at2759", "url": "http://www.orthodb.org/?query=981551at2759", "database": "OrthoDB" }, { "id": "PF00178", "url": "http://pfam.xfam.org/family/PF00178", "database": "Pfam" }, { "id": "PR_A4GTP4", "url": "http://purl.obolibrary.org/obo/PR_A4GTP4", "database": "PRO" }, { "id": "NP_001101529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529", "database": "RefSeq" }, { "id": "1598663", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1598663", "database": "RGD" }, { "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4", "database": "UniProtKB" }, { "id": "A4GTP4-1", "url": "https://www.uniprot.org/uniprot/A4GTP4-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAVAMAPATVHSGPGDNATGKPGTPKGAGMTGQGGLARSSRNEYMRSGLYSTFTIQSLQPQPPLHPRPASVLPNTTPAGVPAPPSGSRSTSPNPLEACLEAEEAGLPLQVILTPPEAPNQKSEELSLNPGFGRPQPPEVKVEGPKEELEVTEVGGFSPEAVKAEQEVSPSEGLLARLPAILTENTAQVCGLSTSTTEITQPQKGRKPRDLELPLSPSLLGGQGPERTPGSGTSSGLQAQGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP", "length": 427, "header": "sp|A4GTP4-1|ELK1_RAT Isoform 1 of ETS domain-containing protein Elk-1 OS=Rattus norvegicus OX=10116 GN=Elk1 PE=1 SV=1 CANONICAL=A4GTP4-1" }, "isoforms": [ { "isoform_ac": "A4GTP4-1", "url": "https://www.uniprot.org/uniprot/A4GTP4#A4GTP4-1", "sequence": { "sequence": "MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAVAMAPATVHSGPGDNATGKPGTPKGAGMTGQGGLARSSRNEYMRSGLYSTFTIQSLQPQPPLHPRPASVLPNTTPAGVPAPPSGSRSTSPNPLEACLEAEEAGLPLQVILTPPEAPNQKSEELSLNPGFGRPQPPEVKVEGPKEELEVTEVGGFSPEAVKAEQEVSPSEGLLARLPAILTENTAQVCGLSTSTTEITQPQKGRKPRDLELPLSPSLLGGQGPERTPGSGTSSGLQAQGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP", "length": 427, "header": "sp|A4GTP4-1|ELK1_RAT Isoform 1 of ETS domain-containing protein Elk-1 OS=Rattus norvegicus OX=10116 GN=Elk1 PE=1 SV=1 CANONICAL=A4GTP4-1" }, "locus": { "chromosome": "X", "start_pos": 1303526, "end_pos": 1297144, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000013522", "url": "https://www.ensembl.org/id/ENSRNOT00000013522" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000013522", "url": "https://www.ensembl.org/id/ENSRNOP00000013522" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 323, "end_pos": 323, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK1", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ] }, { "start_pos": 335, "end_pos": 335, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK1", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ] }, { "start_pos": 352, "end_pos": 352, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK1", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ] }, { "start_pos": 362, "end_pos": 362, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK1", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ] }, { "start_pos": 367, "end_pos": 367, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK1", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ] }, { "start_pos": 382, "end_pos": 382, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK1 and MAPK8", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ] }, { "start_pos": 388, "end_pos": 388, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK1", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ] }, { "start_pos": 416, "end_pos": 416, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK1", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ] }, { "start_pos": 421, "end_pos": 421, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK1", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ] } ], "glycation": [], "keywords": [], "publication": [ { "title": "JNK- and Rac1-dependent induction of immediate early gene pip92 suppresses neuronal differentiation.", "journal": "J. Neurochem.", "date": "2007", "authors": "Kim E.J., Chung K.C., Park J.B., Seo S.R., Yang E.J.", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "reference": [ { "type": "PubMed", "id": "17156131", "url": "https://glygen.org/publication/PubMed/17156131" } ] }, { "title": "Centaurin-alpha1-Ras-Elk-1 signaling at mitochondria mediates beta-amyloid-induced synaptic dysfunction.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2013", "authors": "Szatmari EM, Oliveira AF, Sumner EJ, Yasuda R", "evidence": [ { "database": "RefSeq", "id": "NP_001101529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529" } ], "reference": [ { "type": "PubMed", "id": "23516302", "url": "https://glygen.org/publication/PubMed/23516302" } ] }, { "title": "Insulin-activated Elk-1 recruits the TIP60/NuA4 complex to increase prolactin gene transcription.", "journal": "Molecular and cellular endocrinology", "date": "2014", "authors": "Mahajan MA, Stanley FM", "evidence": [ { "database": "RefSeq", "id": "NP_001101529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529" } ], "reference": [ { "type": "PubMed", "id": "24075908", "url": "https://glygen.org/publication/PubMed/24075908" } ] }, { "title": "ETS-domain containing protein (Elk1) suppression protects cortical neurons against oxygen-glucose deprivation injury.", "journal": "Experimental cell research", "date": "2018", "authors": "Lu Z, Miao Z, Zhu J, Zhu G", "evidence": [ { "database": "RefSeq", "id": "NP_001101529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529" } ], "reference": [ { "type": "PubMed", "id": "30053446", "url": "https://glygen.org/publication/PubMed/30053446" } ] } ], "pathway": [ { "id": "rno:314436", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:314436", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P19419-1", "protein_name": "ETS domain-containing protein Elk-1", "gene_name": "ELK1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP", "length": 428 }, "evidence": [ { "id": "3832", "url": "http://www.informatics.jax.org/homology/3832", "database": "MGI" }, { "id": "A4GTP4", "url": "https://omabrowser.org/oma/group/A4GTP4/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P41969-1", "protein_name": "ETS domain-containing protein Elk-1", "gene_name": "Elk1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAIAMAPATVHAGPGDTATGKPGTPKGAGMTGQGGLARSSRNEYMRSGLYSTFTIQSLQPQPQPPIPPRPASVLPNTTPAGVPAPASGSRSTSPNPLEACLEAEEAGLPLQVILTPPEAPNQKSEELSLDPSFGHPQPPEVKVEGPKEELEAARAGGFSSEAVKAEPEVSASEGLLARLPAILTENTAQVCGLSTSTTEITQPQKGRKPRDLELPLSPSLLGGQGPERTPGSGTSSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP", "length": 429 }, "evidence": [ { "id": "3832", "url": "http://www.informatics.jax.org/homology/3832", "database": "MGI" }, { "id": "A4GTP4", "url": "https://omabrowser.org/oma/group/A4GTP4/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 14, "go_terms": [ { "name": "liver development", "id": "GO:0001889", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001889", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "21873635" }, { "name": "cell differentiation", "id": "GO:0030154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "21873635" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "19029245" }, { "name": "cellular response to testosterone stimulus", "id": "GO:0071394", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071394", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "14766003" }, { "name": "positive regulation of neuron death", "id": "GO:1901216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901216", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "16549787" }, { "name": "regulation of transcription, DNA-templated", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "" }, { "name": "lung development", "id": "GO:0030324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030324", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "" }, { "name": "positive regulation of transcription, DNA-templated", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "" }, { "name": "response to light stimulus", "id": "GO:0009416", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009416", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "10383826" }, { "name": "response to fibroblast growth factor", "id": "GO:0071774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071774", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "17156131" }, { "name": "cellular response to gamma radiation", "id": "GO:0071480", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071480", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "17949253" }, { "name": "gene expression", "id": "GO:0010467", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010467", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "" }, { "name": "cellular response to lipid", "id": "GO:0071396", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071396", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "18768922" } ] }, { "name": "Molecular Function", "total": 10, "go_terms": [ { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "18768922" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "" }, { "name": "double-stranded DNA binding", "id": "GO:0003690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003690", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "11557580" }, { "name": "transcription cis-regulatory region binding", "id": "GO:0000976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000976", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "11557580" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "21873635" }, { "name": "nuclear receptor coactivator activity", "id": "GO:0030374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030374", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "" }, { "name": "RNA polymerase II-specific DNA-binding transcription factor binding", "id": "GO:0061629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061629", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "9412502" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "9412502" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "16549787" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "16549787" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "16549787" }, { "name": "axon terminus", "id": "GO:0043679", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043679", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" } ], "pmid": "9412502" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 125, "end_pos": 127, "annotation": "n_glycosylation_sequon" }, { "start_pos": 182, "end_pos": 184, "annotation": "n_glycosylation_sequon" }, { "start_pos": 51, "end_pos": 53, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "On mitogenic stimulation, phosphorylated on C-terminal serine and threonine residues by MAPK1. Ser-382 and Ser-388 are the preferred sites for MAPK1. In vitro, phosphorylation by MAPK1 potentiates ternary complex formation with the serum responses factors, SRE and SRF. Also phosphorylated on Ser-382 by MAPK8 and/or MAKP9. Phosphorylation leads to loss of sumoylation and restores transcriptional activator activity. Phosphorylated and activated by CAMK4, MAPK11, MAPK12 and MAPK14 (By similarity). Upon bFGF stimulus, phosphorylated by PAK1 (PubMed:17156131).", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" }, { "database": "PubMed", "id": "17156131", "url": "https://glygen.org/publication/PubMed/17156131" }, { "database": "PubMed", "id": "P19419", "url": "https://glygen.org/publication/PubMed/P19419" } ] }, { "annotation": "Sumoylation represses transcriptional activator activity as it results in recruitment of HDAC2 to target gene promoters which leads to decreased histone acetylation and reduced transactivator activity. It also regulates nuclear retention.", "evidence": [ { "database": "UniProtKB", "id": "A4GTP4", "url": "https://www.uniprot.org/uniprot/A4GTP4" }, { "database": "PubMed", "id": "P19419", "url": "https://glygen.org/publication/PubMed/P19419" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ] }