{ "uniprot_canonical_ac": "A2VD16-1", "uniprot_ac": "A2VD16", "uniprot_id": "A2VD16_RAT", "mass": { "chemical_mass": 36956.0, "monoisotopic_mass": 36956.0 }, "refseq": { "ac": "NP_001129216", "name": "aldo-keto reductase family 1, member C12-like 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129216" }, "gene_names": [ { "name": "Akr1c12l1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2VD16", "id": "A2VD16" }, { "name": "Akr1c12l1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129216", "id": "NP_001129216" }, { "name": "Akr1c17; RGD1559604", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129216", "id": "NP_001129216" }, { "name": "RGD1559604", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2VD16", "id": "A2VD16" } ], "protein_names": [ { "name": "Aldo-keto reductase family 1, member C12-like 1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2VD16#names_and_taxonomy", "id": "A2VD16" }, { "name": "aldo-keto reductase family 1, member C12-like 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129216", "id": "NP_001129216" } ], "function": [ { "annotation": "AKR1C17 is a member of the aldo-keto reductase family highly expressed in kidney cytosol.", "evidence": [ { "database": "RefSeq", "id": "NP_001129216", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129216" }, { "database": "PubMed", "id": "17475203", "url": "https://glygen.org/publication/PubMed/17475203" } ] } ], "disease": [ { "disease_id": "DOID:0060074", "recommended_name": { "id": "DOID:0060074", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060074", "name": "ductal carcinoma in situ", "description": "A breast carcinoma in situ that is characterized by being non-invasive, not having spread outside of the duct into the surrounding breast tissue, has_material_basis_in abnormally proliferating cells, derives_from epithelial cells." }, "synonyms": [], "evidence": [ { "id": "0060074", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060074" } ] }, { "disease_id": "DOID:0080630", "recommended_name": { "id": "DOID:0080630", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080630", "name": "B-lymphoblastic leukemia/lymphoma", "description": "A B-cell acute lymphoblastic leukemia that is characterized by the presence of too many B-cell lymphoblasts in the blood and bone marrow." }, "synonyms": [ { "id": "DOID:0080630", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080630", "name": "precursor B lymphoblastic lymphoma/leukemia", "description": "" }, { "id": "DOID:0080630", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080630", "name": "B-ALL", "description": "" } ], "evidence": [ { "id": "0080630", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080630" } ] }, { "disease_id": "DOID:0111773", "recommended_name": { "id": "DOID:0111773", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111773", "name": "46,XY sex reversal 8", "description": "A 46 XY sex reversal characterized by an XY karyotype, phenotypically female genitalia and failure to develop secondary sexual characteristics at puberty including menstruation that has_material_basis_in homozygous or compound heterozygous mutation in AKR1C2 on chromosome 10p15.1." }, "synonyms": [ { "id": "DOID:0111773", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111773", "name": "SRXY8", "description": "" }, { "id": "DOID:0111773", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111773", "name": "TDD", "description": "" }, { "id": "DOID:0111773", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111773", "name": "male pseudohermaphroditism due to deficiency of testicular 17,20-desmolase", "description": "" }, { "id": "MONDO:0013664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013664", "name": "46,XY disorder of sex development due to testicular 17,20-desmolase deficiency", "description": "" }, { "id": "MONDO:0013664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013664", "name": "SRXY8", "description": "" }, { "id": "MONDO:0013664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013664", "name": "male pseudohermaphroditism due to deficiency of testicular 17,20-desmolase", "description": "" }, { "id": "MONDO:0013664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013664", "name": "46,XY sex reversal 8", "description": "" }, { "id": "MONDO:0013664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013664", "name": "46,XY sex reversal 8; SRXY8", "description": "" }, { "id": "MONDO:0013664", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013664", "name": "46,XY sex reversal type 8", "description": "" }, { "id": "MIM:614279", "resource": "MIM", "url": "https://www.omim.org/entry/614279", "name": "46,XY sex reversal 8", "description": "46,XY sex reversal 8" } ], "evidence": [ { "id": "0111773", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0111773" } ] }, { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12; HPC12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13; HPC13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7; HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1; HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11; HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14; HPC14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15; HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1; HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2; HPCX2", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10; HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ], "evidence": [ { "id": "10283", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] }, { "disease_id": "DOID:10591", "recommended_name": { "id": "DOID:10591", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10591", "name": "pre-eclampsia", "description": "A hypertension occurring during pregnancy characterized by large amounts of protein in the urine (proteinuria) and edema, usually by the last trimester of pregnancy." }, "synonyms": [ { "id": "DOID:10591", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10591", "name": "gestational hypertension", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10591", "name": "hypertension induced by pregnancy", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10591", "name": "pre-eclamptic toxaemia", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10591", "name": "preeclampsia", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10591", "name": "preeclampsia/eclampsia", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10591", "name": "pregnancy associated hypertension", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10591", "name": "pregnancy toxemia", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10591", "name": "proteinuric hypertension of pregnancy", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10591", "name": "toxaemia of pregnancy", "description": "" }, { "id": "MONDO:0012266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012266", "name": "preeclampsia/eclampsia 4", "description": "Any preeclampsia in which the cause of the disease is a mutation in the STOX1 gene." }, { "id": "MONDO:0012266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012266", "name": "preeclampsia caused by mutation in STOX1", "description": "" }, { "id": "MONDO:0012266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012266", "name": "PREECLAMPSIA/eclampsia 4; PEE4", "description": "" }, { "id": "MONDO:0012266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012266", "name": "PEE4", "description": "" }, { "id": "MONDO:0012266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012266", "name": "Preeclampsia/eclampsia type 4", "description": "" }, { "id": "MONDO:0012266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012266", "name": "preeclampsia/eclampsia 4", "description": "" }, { "id": "MONDO:0012266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012266", "name": "STOX1 preeclampsia", "description": "" }, { "id": "MONDO:0012265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012265", "name": "PEE3", "description": "" }, { "id": "MONDO:0012265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012265", "name": "PREECLAMPSIA/eclampsia 3", "description": "" }, { "id": "MONDO:0012265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012265", "name": "PREECLAMPSIA/eclampsia 3; PEE3", "description": "" }, { "id": "MONDO:0012265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012265", "name": "PEE3", "description": "" }, { "id": "MONDO:0012264", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012264", "name": "PEE2", "description": "" }, { "id": "MONDO:0012264", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012264", "name": "PREECLAMPSIA/eclampsia 2", "description": "" }, { "id": "MONDO:0012264", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012264", "name": "PEE2", "description": "" }, { "id": "MONDO:0012264", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012264", "name": "PREECLAMPSIA/eclampsia 2; PEE2", "description": "" }, { "id": "MONDO:0008585", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008585", "name": "HELLP syndrome", "description": "HELLP syndrome is a life-threatening condition that can potentially complicate pregnancy. It is named for 3 features of the condition: H emolysis, E levated L iver enzyme levels, and L ow P latelet levels. It typically occurs in the last 3 months of pregnancy (the third trimester) but can also start soon after delivery. A wide range of non-specific symptoms may be present in women with HELLP syndrome. Symptoms may include fatigue; malaise; fluid retention and excess weight gain; headache; nausea and vomiting; pain in the upper right or middle of the abdomen; blurry vision; and rarely, nosebleed or seizures. The cause of HELLP syndrome is not known, but certain risk factors have been associated with the condition. It is most common in women with preeclampsia or eclampsia . If not diagnosed and treated quickly, HELLP syndrome can lead to serious complications for the mother and baby.The main treatment is to deliver the baby as soon as possible, even if premature. Treatment may also includemedications needed for the mother or baby, and blood transfusion for severe bleeding problems." }, { "id": "MONDO:0008585", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008585", "name": "PREECLAMPSIA/eclampsia 1", "description": "" }, { "id": "MONDO:0008585", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008585", "name": "hypertension, pregnancy-induced", "description": "" }, { "id": "MONDO:0008585", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008585", "name": "pee", "description": "" }, { "id": "MONDO:0008585", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008585", "name": "hemolysis-elevated liver enzymes-low platelets syndrome", "description": "" }, { "id": "MONDO:0008585", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008585", "name": "PREECLAMPSIA/eclampsia 1; PEE1", "description": "" }, { "id": "MONDO:0008585", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008585", "name": "hemolysis, elevated liver enzymes, low platelets in pregnancy", "description": "" }, { "id": "MONDO:0008585", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008585", "name": "Preg1", "description": "" }, { "id": "MONDO:0008585", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008585", "name": "PEE1", "description": "" }, { "id": "MONDO:0008585", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008585", "name": "hemolysis, elevated liver enzymes, lowered platelets", "description": "" }, { "id": "MONDO:0008585", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008585", "name": "hemolysis-elevated liver enzymes-Low Platelet count syndrome", "description": "" }, { "id": "MONDO:0008585", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008585", "name": "toxemia of pregnancy", "description": "" }, { "id": "MONDO:0008585", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008585", "name": "hemolysis, elevated liver enzymes, and Low Platelet count", "description": "" }, { "id": "MONDO:0013815", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013815", "name": "FGFR2-related bent bone dysplasia", "description": "" }, { "id": "MONDO:0013815", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013815", "name": "bent bone dysplasia syndrome", "description": "" }, { "id": "MONDO:0013815", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013815", "name": "BBDS", "description": "" }, { "id": "MONDO:0013815", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013815", "name": "bent bone dysplasia (BBD)-FGFR2 type", "description": "" }, { "id": "MONDO:0013815", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013815", "name": "bent bone dysplasia syndrome; BBDS", "description": "" }, { "id": "MONDO:0013815", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013815", "name": "perinatal lethal bent bone dysplasia", "description": "" }, { "id": "MIM:609404", "resource": "MIM", "url": "https://www.omim.org/entry/609404", "name": "Pre-eclampsia/eclampsia 4", "description": "Pre-eclampsia/eclampsia 4" }, { "id": "MIM:614592", "resource": "MIM", "url": "https://www.omim.org/entry/614592", "name": "Bent bone dysplasia syndrome", "description": "Bent bone dysplasia syndrome" } ], "evidence": [ { "id": "10591", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10591" } ] }, { "disease_id": "DOID:1240", "recommended_name": { "id": "DOID:1240", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1240", "name": "leukemia", "description": "A cancer that affects the blood or bone marrow characterized by an abnormal proliferation of blood cells." }, "synonyms": [], "evidence": [ { "id": "1240", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1240" } ] }, { "disease_id": "DOID:5603", "recommended_name": { "id": "DOID:5603", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5603", "name": "T-cell acute lymphoblastic leukemia", "description": "An acute lymphoblastic leukemia that is characterized by too many T-cell lymphoblasts found in the bone marrow and blood." }, "synonyms": [ { "id": "DOID:5603", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5603", "name": "acute T cell leukemia", "description": "" }, { "id": "DOID:5603", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5603", "name": "precursor T-lymphoblastic lymphoma/leukemia", "description": "" }, { "id": "DOID:5603", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5603", "name": "Precursor T Lymphoblastic Leukemia", "description": "" }, { "id": "DOID:5603", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5603", "name": "T Acute Lymphoblastic Leukemia", "description": "" }, { "id": "DOID:5603", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5603", "name": "T-cell acute lymphocytic leukaemia", "description": "" }, { "id": "DOID:5603", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5603", "name": "acute T cell leukaemia", "description": "" } ], "evidence": [ { "id": "5603", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5603" } ] }, { "disease_id": "DOID:9970", "recommended_name": { "id": "DOID:9970", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9970", "name": "obesity", "description": "An overnutrition that is characterized by excess body fat, traditionally defined as an elevated ratio of weight to height (specifically 30 kilograms per meter squared), has_material_basis_in a multifactorial etiology related to excess nutrition intake, decreased caloric utilization, and genetic susceptibility, and possibly medications and certain disorders of metabolism, endocrine function, and mental illness." }, "synonyms": [ { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "monogenic obesity", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity (disease)", "description": "" }, { "id": "MONDO:0019182", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019182", "name": "genetic obesity", "description": "" }, { "id": "MIM:601665", "resource": "MIM", "url": "https://www.omim.org/entry/601665", "name": "Obesity", "description": "Obesity" } ], "evidence": [ { "id": "9970", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9970" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A2VD16", "url": "https://www.uniprot.org/uniprot/A2VD16" } ], "common_name": "Rat" } ], "gene": [ { "name": "Akr1c12l1", "url": "https://www.uniprot.org/uniprot/A2VD16", "locus": { "chromosome": "17", "start_pos": 69588085, "end_pos": 69599142, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000050243", "url": "https://www.ensembl.org/id/ENSRNOG00000050243" } ] } } ], "crossref": [ { "id": "ENSRNOG00000050243", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000050243", "database": "Bgee" }, { "id": "cd19108", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19108", "database": "CDD" }, { "id": "498790", "url": "https://www.ncbi.nlm.nih.gov/gene/498790", "database": "GeneID" }, { "id": "IPR018170", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018170", "database": "InterPro" }, { "id": "IPR020471", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020471", "database": "InterPro" }, { "id": "IPR023210", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023210", "database": "InterPro" }, { "id": "IPR036812", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036812", "database": "InterPro" }, { "id": "IPR044482", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044482", "database": "InterPro" }, { "id": "rno:498790", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:498790", "database": "KEGG Pathway" }, { "id": "LEXVECH", "url": "https://omabrowser.org/oma/group/LEXVECH/", "database": "OMA" }, { "id": "1016440at2759", "url": "http://www.orthodb.org/?query=1016440at2759", "database": "OrthoDB" }, { "id": "PF00248", "url": "http://pfam.xfam.org/family/PF00248", "database": "Pfam" }, { "id": "NP_001129216", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129216", "database": "RefSeq" }, { "id": "1559604", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1559604", "database": "RGD" }, { "id": "A2VD16", "url": "https://www.uniprot.org/uniprot/A2VD16", "database": "UniProtKB" }, { "id": "A2VD16-1", "url": "https://www.uniprot.org/uniprot/A2VD16-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MSSKHHCVKLNDGHFIPALGFGTSIPNEVPKSKSLEAVHLAIDAGYHHIDTASAYQIEEEIGQAIQSKIKAGVVKREDMFITTKLWCTCFRPELVKPALEKSLKNLQLDYADLYIMHYPVPMKSGDKYLPVDDKGKWLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVECHLYMNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLDDPVLCDVAKKNKRSPALIALRYLVQREVVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLSAEFLAGHPEYPFSEEY", "length": 323, "header": "tr|A2VD16-1|A2VD16_RAT Isoform 1 of Aldo-keto reductase family 1, member C12-like 1 OS=Rattus norvegicus OX=10116 GN=Akr1c12l1 PE=2 SV=1 CANONICAL=A2VD16-1" }, "isoforms": [ { "isoform_ac": "A2VD16-1", "url": "https://www.uniprot.org/uniprot/A2VD16#A2VD16-1", "sequence": { "sequence": "MSSKHHCVKLNDGHFIPALGFGTSIPNEVPKSKSLEAVHLAIDAGYHHIDTASAYQIEEEIGQAIQSKIKAGVVKREDMFITTKLWCTCFRPELVKPALEKSLKNLQLDYADLYIMHYPVPMKSGDKYLPVDDKGKWLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVECHLYMNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLDDPVLCDVAKKNKRSPALIALRYLVQREVVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLSAEFLAGHPEYPFSEEY", "length": 323, "header": "tr|A2VD16-1|A2VD16_RAT Isoform 1 of Aldo-keto reductase family 1, member C12-like 1 OS=Rattus norvegicus OX=10116 GN=Akr1c12l1 PE=2 SV=1 CANONICAL=A2VD16-1" }, "locus": { "chromosome": "17", "start_pos": 69598949, "end_pos": 69588146, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000064884", "url": "https://www.ensembl.org/id/ENSRNOT00000064884" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000059125", "url": "https://www.ensembl.org/id/ENSRNOP00000059125" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Rat NAD+-dependent 3alpha-hydroxysteroid dehydrogenase (AKR1C17): a member of the aldo-keto reductase family highly expressed in kidney cytosol.", "journal": "Archives of biochemistry and biophysics", "date": "2007", "authors": "Sanai M, Endo S, Matsunaga T, Ishikura S, Tajima K, El-Kabbani O, Hara A", "evidence": [ { "database": "RefSeq", "id": "NP_001129216", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001129216" } ], "reference": [ { "type": "PubMed", "id": "17475203", "url": "https://glygen.org/publication/PubMed/17475203" } ] } ], "pathway": [ { "id": "rno:498790", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:498790", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZPY8-1", "protein_name": "Aldo-keto reductase family 1, member C13", "gene_name": "Akr1c13", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSSKQHCVKLNDGHFIPALGFGTYKPKEVPKSKSLEAAHLAIDAGYRHIDTAYAYQIEEEIGQAIQSKIKAGVVKREDMFITTKLWCTCFRPELVKPALEKSLKNLQLDYADLYIMHYPVPMKSGDNDFPVDEKGKSLLDTVDFCDTWEMLEKCKDAGLVKSIGVSNFNHKQLERLLNKPGLKYKPVCNQVECHLYLNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLNDPVLCDVAKKNKRSPALIALRYLVQRGVVPLAQSFKENEMRENLQVFDFQLSPEDMKTLDGLNKNFRYLSAEFLAGHPEYPFSEEY", "length": 323 }, "evidence": [ { "id": "121208", "url": "http://www.informatics.jax.org/homology/121208", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8VC28-1", "protein_name": "Aldo-keto reductase family 1 member C13", "gene_name": "Akr1c13", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSSKQHCVKLNDGHLIPALGFGTYKPKEVPKSKSLEAACLALDVGYRHVDTAYAYQVEEEIGQAIQSKIKAGVVKREDLFITTKLWCTCFRPELVKPALEKSLKKLQLDYVDLYIMHYPVPMKSGDNDFPVNEQGKSLLDTVDFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKPGLKYKPVCNQVECHLYLNQRKLLDYCESKDIVLVAYGALGTQRYKEWVDQNSPVLLNDPVLCDVAKKNKRSPALIALRYLIQRGIVPLAQSFKENEMRENLQVFGFQLSPEDMKTLDGLNKNFRYLPAEFLVDHPEYPFVEEY", "length": 323 }, "evidence": [ { "id": "121208", "url": "http://www.informatics.jax.org/homology/121208", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JLI0-1", "protein_name": "Aldo-keto reductase a", "gene_name": "Akr1c12", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSSKQHYVKLNDGHLIPALGFGTYKPKEVPKSKSLEAACLALDVGYRHVDTAYAYQVEEEIGQAIQSKIKAGVVKREDLFITTKLWCGCFRPELVKPALEKSLKSLQLDYVDLYLIHYPVPMKPGDNESPLDENGKFLLDTVDFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKPGLKYKPVCNQVECHLYLNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLNDPVLCDVAKRNKRSPALIALRYLFQRGIVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLNKNFRYLPAEFLADHPEYPFSEEY", "length": 323 }, "evidence": [ { "id": "121208", "url": "http://www.informatics.jax.org/homology/121208", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "steroid dehydrogenase activity", "id": "GO:0016229", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016229", "evidence": [ { "database": "UniProtKB", "id": "A2VD16", "url": "https://www.uniprot.org/uniprot/A2VD16" } ], "pmid": "21873635" }, { "name": "alditol:NADP+ 1-oxidoreductase activity", "id": "GO:0004032", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004032", "evidence": [ { "database": "UniProtKB", "id": "A2VD16", "url": "https://www.uniprot.org/uniprot/A2VD16" } ], "pmid": "21873635" }, { "name": "ketosteroid monooxygenase activity", "id": "GO:0047086", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047086", "evidence": [ { "database": "UniProtKB", "id": "A2VD16", "url": "https://www.uniprot.org/uniprot/A2VD16" } ], "pmid": "21873635" }, { "name": "D-threo-aldose 1-dehydrogenase activity", "id": "GO:0047834", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047834", "evidence": [ { "database": "UniProtKB", "id": "A2VD16", "url": "https://www.uniprot.org/uniprot/A2VD16" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A2VD16", "url": "https://www.uniprot.org/uniprot/A2VD16" } ], "pmid": "21873635" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "steroid metabolic process", "id": "GO:0008202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008202", "evidence": [ { "database": "UniProtKB", "id": "A2VD16", "url": "https://www.uniprot.org/uniprot/A2VD16" } ], "pmid": "21873635" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 198, "end_pos": 200, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ] }