{
    "uniprot_canonical_ac": "A2RT31-1",
    "uniprot_ac": "A2RT31",
    "uniprot_id": "A2RT31_MOUSE",
    "mass": {
        "chemical_mass": 35760.0,
        "monoisotopic_mass": 35760.0
    },
    "refseq": {
        "ac": "NP_666440",
        "name": "olfactory receptor 110",
        "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440"
    },
    "gene_names": [
        {
            "name": "Olfr110",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A2RT31",
            "id": "A2RT31"
        },
        {
            "name": "MOR249-2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440",
            "id": "NP_666440"
        },
        {
            "name": "Olfr110",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440",
            "id": "NP_666440"
        }
    ],
    "protein_names": [
        {
            "name": "Olfactory receptor",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/A2RT31#names_and_taxonomy",
            "id": "A2RT31"
        },
        {
            "name": "olfactory receptor 110",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440",
            "id": "NP_666440"
        },
        {
            "name": "olfactory receptor MOR249-2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440",
            "id": "NP_666440"
        }
    ],
    "function": [
        {
            "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_666440",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440"
                }
            ]
        },
        {
            "annotation": "Olfr110/111 and Olfr544 proteins are mainly expressed by neurons in cortical and hippocampal regions and, to a lesser extent, by glia and endothelial cells. expression of the mRNA encoding for Olfr110/111 tends to increase with age in both the cortex and hippocampus of wild-type and transgenic mice. Moreover, Olfr110/111 transcript expression is markedly impaired in the brain of Alzheimer's disease-like mice.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_666440",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440"
                },
                {
                    "database": "PubMed",
                    "id": "29984401",
                    "url": "https://glygen.org/publication/PubMed/29984401"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A2RT31",
                    "url": "https://www.uniprot.org/uniprot/A2RT31"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Olfr110",
            "url": "https://www.uniprot.org/uniprot/A2RT31",
            "locus": {
                "chromosome": "17",
                "start_pos": 37492468,
                "end_pos": 37500207,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000090894",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000090894"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000090894",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000090894",
            "database": "Bgee"
        },
        {
            "id": "258325",
            "url": "https://www.ncbi.nlm.nih.gov/gene/258325",
            "database": "GeneID"
        },
        {
            "id": "IPR000276",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276",
            "database": "InterPro"
        },
        {
            "id": "IPR000725",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725",
            "database": "InterPro"
        },
        {
            "id": "IPR017452",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452",
            "database": "InterPro"
        },
        {
            "id": "mmu:258325",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258325",
            "database": "KEGG Pathway"
        },
        {
            "id": "2177493",
            "url": "http://www.informatics.jax.org/marker/MGI:2177493",
            "database": "MGI"
        },
        {
            "id": "PNELQFL",
            "url": "https://omabrowser.org/oma/group/PNELQFL/",
            "database": "OMA"
        },
        {
            "id": "950898at2759",
            "url": "http://www.orthodb.org/?query=950898at2759",
            "database": "OrthoDB"
        },
        {
            "id": "PF13853",
            "url": "http://pfam.xfam.org/family/PF13853",
            "database": "Pfam"
        },
        {
            "id": "NP_666440",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440",
            "database": "RefSeq"
        },
        {
            "id": "A2RT31",
            "url": "https://www.uniprot.org/uniprot/A2RT31",
            "database": "UniProtKB"
        },
        {
            "id": "A2RT31-1",
            "url": "https://www.uniprot.org/uniprot/A2RT31-1",
            "database": "UniProtKB"
        }
    ],
    "sequence": {
        "sequence": "MEGKNQTAPSEFIILGFDHLNELQYLLFTIFFLTYICTLGGNVFIIVVTIADSHLHTPMYYFLGNLALIDICYTTTNVPQMMVHLLSEKKIISYGGCVTQLFAFIFFVGSECLLLAAMAYDRYIAICKPLRYSFIMNKALCSWLAASCWTGGFLNSVLHTVLTFHLPFCGNNQINYFFCDIPPLLILSCGDTSLNELALLSIGILIGWTPFLCVILSYLYIISTILRIRSSEGRHKAFSTCASHLLIVILYYGSAIFTYVRPISSYSLEKDRLISVLYSVVTPMLNPVIYTLRNKDIKEAVKAIGRKWQPPVFSSDI",
        "length": 317,
        "header": "tr|A2RT31-1|A2RT31_MOUSE Isoform 1 of Olfactory receptor  OS=Mus musculus OX=10090 GN=Olfr110 PE=2 SV=1 CANONICAL=A2RT31-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A2RT31-1",
            "url": "https://www.uniprot.org/uniprot/A2RT31#A2RT31-1",
            "sequence": {
                "sequence": "MEGKNQTAPSEFIILGFDHLNELQYLLFTIFFLTYICTLGGNVFIIVVTIADSHLHTPMYYFLGNLALIDICYTTTNVPQMMVHLLSEKKIISYGGCVTQLFAFIFFVGSECLLLAAMAYDRYIAICKPLRYSFIMNKALCSWLAASCWTGGFLNSVLHTVLTFHLPFCGNNQINYFFCDIPPLLILSCGDTSLNELALLSIGILIGWTPFLCVILSYLYIISTILRIRSSEGRHKAFSTCASHLLIVILYYGSAIFTYVRPISSYSLEKDRLISVLYSVVTPMLNPVIYTLRNKDIKEAVKAIGRKWQPPVFSSDI",
                "length": 317,
                "header": "tr|A2RT31-1|A2RT31_MOUSE Isoform 1 of Olfactory receptor  OS=Mus musculus OX=10090 GN=Olfr110 PE=2 SV=1 CANONICAL=A2RT31-1"
            },
            "locus": {
                "chromosome": "17",
                "start_pos": 37810494,
                "end_pos": 37809544,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000216472",
                        "url": "https://www.ensembl.org/id/ENSMUST00000216472"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000149213",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000149213"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Expression of the Cerebral Olfactory Receptors Olfr110/111 and Olfr544 Is Altered During Aging and in Alzheimer's Disease-Like Mice.",
            "journal": "Molecular neurobiology",
            "date": "2019",
            "authors": "Gaudel F, Stephan D, Landel V, Sicard G, Feron F, Guiraudie-Capraz G",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_666440",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29984401",
                    "url": "https://glygen.org/publication/PubMed/29984401"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:258325",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258325",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q7TRK1-1",
            "protein_name": "Olfactory receptor",
            "gene_name": "Olfr111",
            "tax_id": 10090,
            "organism": "Mus musculus",
            "sequence": {
                "sequence": "MEGKNQTAPSEFIILGFDHLNELQYLLFTIFFLTYICTLGGNVFIIVVTIADSHLHTPMYYFLGNLALIDICYTTTNVPQMMVHLLSEKKIISYGGCVTQLFAFIFFVGSECLLLAAMAYDRYIAICKPLRYSFIMNKALCSWLAASCWTCGFLNSVLHTVLTFHLPFCGNNQINYFFCDIPPLLILSCGDTSLNELALLSIGILIGWTPFLCIILSYLYIISTILRIRSSEGRQKAFSTCASHLLIVILYYGSAIFTYVRPISSYSLEKDRLISVLYSVFTPMLNPIIYALRNKDIKEAVKAIGRKWQPPVFSSDM",
                "length": 317
            },
            "evidence": [
                {
                    "id": "73968",
                    "url": "http://www.informatics.jax.org/homology/73968",
                    "database": "MGI"
                }
            ],
            "common_name": "Mouse"
        },
        {
            "uniprot_canonical_ac": "Q9UGF6-1",
            "protein_name": "Olfactory receptor 5V1",
            "gene_name": "OR5V1",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MERKNQTAITEFIILGFSNLNELQFLLFTIFFLTYFCTLGGNILIILTTVTDPHLHTPMYYFLGNLAFIDICYTTSNVPQMMVHLLSKKKSISYVGCVVQLFAFVFFVGSECLLLAAMAYDRYIAICNPLRYSVILSKVLCNQLAASCWAAGFLNSVVHTVLTFCLPFCGNNQINYFFCDIPPLLILSCGNTSVNELALLSTGVFIGWTPFLCIVLSYICIISTILRIQSSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEAVKTIGSKWQPPISSLDSKLTY",
                "length": 321
            },
            "evidence": [
                {
                    "id": "73968",
                    "url": "http://www.informatics.jax.org/homology/73968",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor activity",
                        "id": "GO:0004930",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A2RT31",
                                "url": "https://www.uniprot.org/uniprot/A2RT31"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "olfactory receptor activity",
                        "id": "GO:0004984",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A2RT31",
                                "url": "https://www.uniprot.org/uniprot/A2RT31"
                            }
                        ],
                        "pmid": "14611657"
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A2RT31",
                                "url": "https://www.uniprot.org/uniprot/A2RT31"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "integral component of membrane",
                        "id": "GO:0016021",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A2RT31",
                                "url": "https://www.uniprot.org/uniprot/A2RT31"
                            }
                        ],
                        "pmid": "14611657"
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 2,
                "go_terms": [
                    {
                        "name": "G protein-coupled receptor signaling pathway",
                        "id": "GO:0007186",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A2RT31",
                                "url": "https://www.uniprot.org/uniprot/A2RT31"
                            }
                        ],
                        "pmid": "14611657"
                    },
                    {
                        "name": "sensory perception of smell",
                        "id": "GO:0007608",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "A2RT31",
                                "url": "https://www.uniprot.org/uniprot/A2RT31"
                            }
                        ],
                        "pmid": "14611657"
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 5,
            "end_pos": 7,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ]
}