{ "uniprot_canonical_ac": "A2RST1-1", "uniprot_ac": "A2RST1", "uniprot_id": "MGST2_MOUSE", "mass": { "chemical_mass": 16786.0, "monoisotopic_mass": 16786.0 }, "refseq": { "ac": "NP_001297411", "name": "microsomal glutathione S-transferase 2 isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297411" }, "gene_names": [ { "name": "Mgst2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1" }, { "name": "GST2; MGST-II", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297411", "id": "NP_001297411" }, { "name": "Gst2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1" }, { "name": "Mgst2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297411", "id": "NP_001297411" } ], "protein_names": [ { "name": "Microsomal glutathione S-transferase 2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "id": "A2RST1" }, { "name": "1.11.1.-", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "id": "A2RST1" }, { "name": "2.5.1.18", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "id": "A2RST1" }, { "name": "4.4.1.20", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "id": "A2RST1" }, { "name": "Glutathione peroxidase MGST2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "id": "A2RST1" }, { "name": "Leukotriene C4 synthase MGST2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "id": "A2RST1" }, { "name": "Microsomal GST-2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "id": "A2RST1" }, { "name": "Microsomal GST-II", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "id": "A2RST1" }, { "name": "Microsomal glutathione S-transferase II", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "id": "A2RST1" }, { "name": "microsomal GST-2; microsomal GST-II; glutathione peroxidase MGST2; leukotriene C4 synthase MGST2; microsomal glutathione S-transferase II", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778160", "id": "NP_778160" }, { "name": "microsomal glutathione S-transferase 2 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778160", "id": "NP_778160" }, { "name": "microsomal glutathione S-transferase 2 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297411", "id": "NP_001297411" } ], "function": [ { "annotation": "Catalyzes several different glutathione-dependent reactions. Catalyzes the glutathione-dependent reduction of lipid hydroperoxides, such as 5-HPETE. Has glutathione transferase activity, toward xenobiotic electrophiles, such as 1-chloro-2, 4-dinitrobenzene (CDNB). Catalyzes also the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4 (LTC4) (By similarity). Involved in oxidative DNA damage induced by ER stress and anticancer agents by activating LTC4 biosynthetic machinery in nonimmune cells (PubMed:26656251).", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1#function" }, { "database": "PubMed", "id": "Q99735", "url": "https://glygen.org/publication/PubMed/Q99735" }, { "database": "PubMed", "id": "26656251", "url": "https://glygen.org/publication/PubMed/26656251" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Mgst2", "url": "https://www.uniprot.org/uniprot/A2RST1", "locus": { "chromosome": "3", "start_pos": 51660360, "end_pos": 51682677, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000074604", "url": "https://www.ensembl.org/id/ENSMUSG00000074604" } ] } } ], "crossref": [ { "id": "ENSMUSG00000074604", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000074604", "database": "Bgee" }, { "id": "211666", "url": "https://www.ncbi.nlm.nih.gov/gene/211666", "database": "GeneID" }, { "id": "IPR001129", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001129", "database": "InterPro" }, { "id": "IPR001446", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001446", "database": "InterPro" }, { "id": "IPR023352", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023352", "database": "InterPro" }, { "id": "mmu:211666", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:211666", "database": "KEGG Pathway" }, { "id": "2448481", "url": "http://www.informatics.jax.org/marker/MGI:2448481", "database": "MGI" }, { "id": "HKYFWGY", "url": "https://omabrowser.org/oma/group/HKYFWGY/", "database": "OMA" }, { "id": "1609516at2759", "url": "http://www.orthodb.org/?query=1609516at2759", "database": "OrthoDB" }, { "id": "PF01124", "url": "http://pfam.xfam.org/family/PF01124", "database": "Pfam" }, { "id": "PR_A2RST1", "url": "http://purl.obolibrary.org/obo/PR_A2RST1", "database": "PRO" }, { "id": "R-MMU-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-156590", "database": "Reactome" }, { "id": "R-MMU-5423646", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5423646", "database": "Reactome" }, { "id": "NP_001297411", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297411", "database": "RefSeq" }, { "id": "NP_778160", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778160", "database": "RefSeq" }, { "id": "16437", "url": "https://www.rhea-db.org/rhea/16437", "database": "Rhea" }, { "id": "17617", "url": "https://www.rhea-db.org/rhea/17617", "database": "Rhea" }, { "id": "48620", "url": "https://www.rhea-db.org/rhea/48620", "database": "Rhea" }, { "id": "51220", "url": "https://www.rhea-db.org/rhea/51220", "database": "Rhea" }, { "id": "A0A0A6YWX7", "url": "https://www.uniprot.org/uniprot/A0A0A6YWX7", "database": "UniProtKB" }, { "id": "A0A0A6YWX7-1", "url": "https://www.uniprot.org/uniprot/A0A0A6YWX7-1", "database": "UniProtKB" }, { "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1", "database": "UniProtKB" }, { "id": "A2RST1-1", "url": "https://www.uniprot.org/uniprot/A2RST1-1", "database": "UniProtKB" }, { "id": "E0CZ62", "url": "https://www.uniprot.org/uniprot/E0CZ62", "database": "UniProtKB" }, { "id": "E0CZ62-1", "url": "https://www.uniprot.org/uniprot/E0CZ62-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAQQNSLEFYPVFIVMLWMAGWYFNQVFAACLGLLYIYARHKYFWGYAEAAEKRITGFRLSLGILTLLPVLAVLGVASRFLNEYLDFHVAKKLRKPF", "length": 147, "header": "sp|A2RST1-1|MGST2_MOUSE Isoform 1 of Microsomal glutathione S-transferase 2 OS=Mus musculus OX=10090 GN=Mgst2 PE=2 SV=1 CANONICAL=A2RST1-1" }, "isoforms": [ { "isoform_ac": "A0A0A6YWX7-1", "url": "https://www.uniprot.org/uniprot/A2RST1#A0A0A6YWX7-1", "sequence": { "sequence": "MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAQQNSLEFYPVFIVMLWMAGWYFNQGSPVSD", "length": 82, "header": "tr|A0A0A6YWX7-1|MGST2_MOUSE Computationally mapped isoform of Microsomal glutathione S-transferase 2 OS=Mus musculus OX=10090 GN=Mgst2 PE=2 SV=1 CANONICAL=A2RST1-1" }, "locus": { "chromosome": "3", "start_pos": 51589891, "end_pos": 51568670, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000159554", "url": "https://www.ensembl.org/id/ENSMUST00000159554" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000141745", "url": "https://www.ensembl.org/id/ENSMUSP00000141745" } ] } }, { "isoform_ac": "A2RST1-1", "url": "https://www.uniprot.org/uniprot/A2RST1#A2RST1-1", "sequence": { "sequence": "MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAQQNSLEFYPVFIVMLWMAGWYFNQVFAACLGLLYIYARHKYFWGYAEAAEKRITGFRLSLGILTLLPVLAVLGVASRFLNEYLDFHVAKKLRKPF", "length": 147, "header": "sp|A2RST1-1|MGST2_MOUSE Isoform 1 of Microsomal glutathione S-transferase 2 OS=Mus musculus OX=10090 GN=Mgst2 PE=2 SV=1 CANONICAL=A2RST1-1" }, "locus": { "chromosome": "3", "start_pos": 51590004, "end_pos": 51568670, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000099106", "url": "https://www.ensembl.org/id/ENSMUST00000099106" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000096705", "url": "https://www.ensembl.org/id/ENSMUSP00000096705" } ] } }, { "isoform_ac": "E0CZ62-1", "url": "https://www.uniprot.org/uniprot/A2RST1#E0CZ62-1", "sequence": { "sequence": "MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAHFCSLSGSPVHIRPSQVFLGLCRSR", "length": 77, "header": "tr|E0CZ62-1|E0CZ62_MOUSE Computationally mapped isoform of Microsomal glutathione S-transferase 2 OS=Mus musculus OX=10090 GN=Mgst2 PE=1 SV=1 CANONICAL=A2RST1-1" }, "locus": { "chromosome": "3", "start_pos": 51589290, "end_pos": 51568670, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000161590", "url": "https://www.ensembl.org/id/ENSMUST00000161590" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000125670", "url": "https://www.ensembl.org/id/ENSMUSP00000125670" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Leukotriene C4 is the major trigger of stress-induced oxidative DNA damage.", "journal": "Nat. Commun.", "date": "2015", "authors": "Rubinstein M., Barak S., Dvash E., Har-Tal M., Meir O.", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "reference": [ { "type": "PubMed", "id": "26656251", "url": "https://glygen.org/publication/PubMed/26656251" } ] } ], "pathway": [ { "id": "mmu:211666", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:211666", "resource": "KEGG Pathway" }, { "id": "R-MMU-156590", "name": "Glutathione conjugation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-156590", "resource": "Reactome", "description": "Glutathione conjugation" }, { "id": "R-MMU-5423646", "name": "Aflatoxin activation and detoxification", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5423646", "resource": "Reactome", "description": "Aflatoxin activation and detoxification" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2JU12-1", "protein_name": "Microsomal glutathione S-transferase 2", "gene_name": "Mgst2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "GYFALQVGRVRLKYKIAPPAVTGSLEFERIFRAQQNSLEFYSVFIISLWMAGWYFNQVFATCLGLLYIYARHKYFWGYAEAAEKRIIGFRLSLGILALLTVLAVLGVASRFLDEYLDFHVAKKLKRPF", "length": 128 }, "evidence": [ { "id": "A2RST1", "url": "https://omabrowser.org/oma/group/A2RST1/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q99735-1", "protein_name": "Microsomal glutathione S-transferase 2", "gene_name": "MGST2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIAKKLRRQF", "length": 147 }, "evidence": [ { "id": "1811", "url": "http://www.informatics.jax.org/homology/1811", "database": "MGI" }, { "id": "A2RST1", "url": "https://omabrowser.org/oma/group/A2RST1/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "enzyme activator activity", "id": "GO:0008047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008047", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" }, { "name": "glutathione transferase activity", "id": "GO:0004364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004364", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" }, { "name": "glutathione binding", "id": "GO:0043295", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043295", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" }, { "name": "leukotriene-C4 synthase activity", "id": "GO:0004464", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004464", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" }, { "name": "glutathione peroxidase activity", "id": "GO:0004602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004602", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "integral component of membrane", "id": "GO:0016021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" }, { "name": "nuclear envelope", "id": "GO:0005635", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005635", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "21873635" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "21873635" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "leukotriene biosynthetic process", "id": "GO:0019370", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019370", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" }, { "name": "glutathione biosynthetic process", "id": "GO:0006750", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006750", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" }, { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" }, { "name": "membrane lipid catabolic process", "id": "GO:0046466", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046466", "evidence": [ { "database": "UniProtKB", "id": "A2RST1", "url": "https://www.uniprot.org/uniprot/A2RST1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "16437", "name": "", "equation": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6AXV9-1", "P00502-1", "O35543-1", "Q6AXY0-1", "Q9Z339-1", "A0A0G2JTB1-1", "P24473-1", "P30713-1", "Q9QX69-1", "Q01579-1", "P04903-1", "P08011-1", "P14942-1", "P57113-1", "Q4V8E6-1", "Q9Z1B2-1", "P04906-1", "P08009-1", "P04905-1", "P08010-1", "Q5BK56-1", "B0BN47-1", "A0A0G2K3C6-1", "Q16772-1", "P28161-1", "Q03013-1", "P21266-1", "O60760-1", "P78417-1", "Q9Y2Q3-1", "P46439-1", "O15217-1", "P09210-1", "P0CG30-1", "P0CG29-1", "Q7RTV2-1", "A0A1W2PR19-1", "O43708-1", "P30711-1", "Q9H4Y5-1", "O43813-1", "P10620-1", "P08263-1", "Q99735-1", "A0A1W2PRG0-1", "P09211-1", "P09488-1", "A2RST1-1", "Q80W21-1", "P10649-1", "Q8R5I6-1", "Q64471-1", "P15626-1", "O09131-1", "P30115-1", "P48774-1", "Q9JHF7-1", "Q9WVL0-1", "Q91VS7-1", "Q61133-1", "P10648-1", "Q9D4P7-1", "O35660-1", "Q99L20-1", "P24472-1", "Q9DCM2-1", "Q8K2Q2-1", "P46425-1", "P19639-1", "P13745-1", "O89112-1", "Q6P8Q0-1", "P19157-1", "Q8MRM0-1", "Q9VG94-1", "Q9VG96-1", "Q7JYX0-1", "E1JJS1-1", "P41043-1", "Q9VG95-1", "Q9VG98-1", "P20432-1", "Q9VG93-1", "Q9VHD2-1", "Q9VHD3-1", "Q7K0B6-1" ], "evidence": [ { "id": "16437", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16437" } ] }, { "id": "17617", "name": "", "equation": "leukotriene C4 = glutathione + leukotriene A4", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5BK56-1", "Q925U2-1", "Q03013-1", "O14880-1", "Q16873-1", "Q99735-1", "A2RST1-1", "Q8R5I6-1", "Q60860-1" ], "evidence": [ { "id": "17617", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17617" } ] }, { "id": "48620", "name": "", "equation": "(5S)-hydroperoxy-(6E,8Z,11Z,14Z)-eicosatetraenoate + 2 glutathione = (5S)-hydroxy-(6E,8Z,11Z,14Z)-eicosatetraenoate + glutathione disulfide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9JHF3-1", "O14880-1", "Q99735-1", "O14684-1", "A2RST1-1", "Q9CPU4-1", "Q9JM51-1" ], "evidence": [ { "id": "48620", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/48620" } ] }, { "id": "51220", "name": "", "equation": "1-chloro-2,4-dinitrobenzene + glutathione = 2,4-dinitrophenyl-S-glutathione + chloride + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9QX69-1", "Q9JHF3-1", "Q5BK56-1", "Q03013-1", "O43813-1", "Q99735-1", "O14684-1", "A2RST1-1", "Q8R5I6-1", "O89112-1", "Q9JM51-1" ], "evidence": [ { "id": "51220", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/51220" } ] }, { "id": "R-MMU-176059", "name": "GST trimers transfer GS from GSH to luminal substrates", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9CPU4-1", "Q91VS7-1", "A2RST1-1" ], "evidence": [ { "id": "R-MMU-176059", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-176059" } ] }, { "id": "R-MMU-5423653", "name": "MGST trimers transfer GS from GSH to AFXBO and AFNBO", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9CPU4-1", "Q91VS7-1", "A2RST1-1" ], "evidence": [ { "id": "R-MMU-5423653", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5423653" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JTB1", "gene_name": "Gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "A0A0G2JTB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JTB1" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A0G2JTB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JTB1" } ] } ] }, { "uniprot_ac": "A0A0G2K3C6", "gene_name": "LOC103694879", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "A0A0G2K3C6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K3C6" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A0G2K3C6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K3C6" } ] } ] }, { "uniprot_ac": "A0A1W2PR19", "gene_name": "GSTT4", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "A0A1W2PR19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PR19" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A1W2PR19", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PR19" } ] } ] }, { "uniprot_ac": "A0A1W2PRG0", "gene_name": "", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "A0A1W2PRG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PRG0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A1W2PRG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2PRG0" } ] } ] }, { "uniprot_ac": "A2RST1", "gene_name": "Mgst2", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione.", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A2RST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2RST1" } ] } ] }, { "uniprot_ac": "B0BN47", "gene_name": "Gstm6", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "B0BN47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0BN47" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "B0BN47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0BN47" } ] } ] }, { "uniprot_ac": "E1JJS1", "gene_name": "GstT3", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.", "evidence": [ { "id": "E1JJS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E1JJS1" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "E1JJS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E1JJS1" } ] } ] }, { "uniprot_ac": "O09131", "gene_name": "Gsto1", "activity": [ { "ec_number": "1.20.4.2", "activity": "Methylarsonate + 2 glutathione = methylarsonite + glutathione disulfide + H(2)O.", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + dehydroascorbate = glutathione disulfide + ascorbate.", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "O09131", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09131" } ] } ] }, { "uniprot_ac": "O14684", "gene_name": "PTGES", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "O14684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14684" } ] }, { "ec_number": "5.3.99.3", "activity": "(5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-11-alpha,15-dihydroxy-9-oxoprosta-5,13-dienoate.", "evidence": [ { "id": "O14684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14684" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "O14684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14684" } ] }, { "ec_number": "5.3.99.3", "activity": "", "evidence": [ { "id": "O14684", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14684" } ] } ] }, { "uniprot_ac": "O14880", "gene_name": "MGST3", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "O14880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14880" } ] }, { "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione.", "evidence": [ { "id": "O14880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14880" } ] } ] }, { "uniprot_ac": "O15217", "gene_name": "GSTA4", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "O15217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15217" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O15217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15217" } ] } ] }, { "uniprot_ac": "O35543", "gene_name": "Hpgds", "activity": [ { "ec_number": "5.3.99.2", "activity": "(5Z,13E,15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E,15S)-9-alpha,15-dihydroxy-11-oxoprosta-5,13-dienoate.", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "O35543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35543" } ] } ] }, { "uniprot_ac": "O35660", "gene_name": "Gstm6", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "O35660", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35660" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O35660", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35660" } ] } ] }, { "uniprot_ac": "O43708", "gene_name": "GSTZ1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "O43708", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43708" } ] } ] }, { "uniprot_ac": "O43813", "gene_name": "LANCL1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "O43813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43813" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O43813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43813" } ] } ] }, { "uniprot_ac": "O60760", "gene_name": "HPGDS", "activity": [ { "ec_number": "5.3.99.2", "activity": "(5Z,13E,15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E,15S)-9-alpha,15-dihydroxy-11-oxoprosta-5,13-dienoate.", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "O60760", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60760" } ] } ] }, { "uniprot_ac": "O89112", "gene_name": "Lancl1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "O89112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89112" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O89112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89112" } ] } ] }, { "uniprot_ac": "P00502", "gene_name": "Gsta1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P00502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00502" } ] } ] }, { "uniprot_ac": "P04903", "gene_name": "Gsta2", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P04903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04903" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04903", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04903" } ] } ] }, { "uniprot_ac": "P04905", "gene_name": "Gstm1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P04905", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04905" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04905", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04905" } ] } ] }, { "uniprot_ac": "P04906", "gene_name": "Gstp1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P04906", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04906" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P04906", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04906" } ] } ] }, { "uniprot_ac": "P08009", "gene_name": "Gstm7", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P08009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08009" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08009" } ] } ] }, { "uniprot_ac": "P08010", "gene_name": "Gstm2", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P08010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08010" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08010", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08010" } ] } ] }, { "uniprot_ac": "P08011", "gene_name": "Mgst1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P08011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08011" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08011" } ] } ] }, { "uniprot_ac": "P08263", "gene_name": "GSTA1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P08263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08263" } ] } ] }, { "uniprot_ac": "P09210", "gene_name": "GSTA2", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P09210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09210" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09210", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09210" } ] } ] }, { "uniprot_ac": "P09211", "gene_name": "GSTP1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P09211", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09211" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09211", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09211" } ] } ] }, { "uniprot_ac": "P09488", "gene_name": "GSTM1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P09488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09488" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P09488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09488" } ] } ] }, { "uniprot_ac": "P0CG29", "gene_name": "GSTT2", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P0CG29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG29" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P0CG29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG29" } ] } ] }, { "uniprot_ac": "P0CG30", "gene_name": "GSTT2B", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P0CG30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG30" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P0CG30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CG30" } ] } ] }, { "uniprot_ac": "P10620", "gene_name": "MGST1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P10620", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10620" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10620", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10620" } ] } ] }, { "uniprot_ac": "P10648", "gene_name": "Gsta2", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P10648", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10648" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10648", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10648" } ] } ] }, { "uniprot_ac": "P10649", "gene_name": "Gstm1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P10649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10649" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P10649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10649" } ] } ] }, { "uniprot_ac": "P13745", "gene_name": "Gsta1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P13745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13745" } ] } ] }, { "uniprot_ac": "P14942", "gene_name": "Gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P14942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14942" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P14942", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14942" } ] } ] }, { "uniprot_ac": "P15626", "gene_name": "Gstm2", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P15626", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15626" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P15626", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15626" } ] } ] }, { "uniprot_ac": "P19157", "gene_name": "Gstp1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P19157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19157" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P19157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19157" } ] } ] }, { "uniprot_ac": "P19639", "gene_name": "Gstm3", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P19639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19639" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P19639", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19639" } ] } ] }, { "uniprot_ac": "P20432", "gene_name": "GstD1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "4.5.1.1", "activity": "1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane = 1,1-dichloro-2,2-bis(4-chlorophenyl)ethylene + chloride.", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] }, { "ec_number": "4.5.1.1", "activity": "", "evidence": [ { "id": "P20432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20432" } ] } ] }, { "uniprot_ac": "P21266", "gene_name": "GSTM3", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P21266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21266" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P21266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21266" } ] } ] }, { "uniprot_ac": "P24472", "gene_name": "Gsta4", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P24472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24472" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P24472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24472" } ] } ] }, { "uniprot_ac": "P24473", "gene_name": "Gstk1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P24473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24473" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P24473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24473" } ] } ] }, { "uniprot_ac": "P28161", "gene_name": "GSTM2", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P28161", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28161" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P28161", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28161" } ] } ] }, { "uniprot_ac": "P30115", "gene_name": "Gsta3", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P30115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30115" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30115" } ] } ] }, { "uniprot_ac": "P30711", "gene_name": "GSTT1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P30711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30711" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30711" } ] } ] }, { "uniprot_ac": "P30713", "gene_name": "Gstt2", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P30713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30713" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P30713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30713" } ] } ] }, { "uniprot_ac": "P41043", "gene_name": "GstS1", "activity": [ { "ec_number": "5.3.99.2", "activity": "(5Z,13E,15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E,15S)-9-alpha,15-dihydroxy-11-oxoprosta-5,13-dienoate.", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] }, { "ec_number": "1.11.1.9", "activity": "2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P41043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41043" } ] } ] }, { "uniprot_ac": "P46425", "gene_name": "Gstp2", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P46425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46425" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P46425", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46425" } ] } ] }, { "uniprot_ac": "P46439", "gene_name": "GSTM5", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P46439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46439" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P46439", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46439" } ] } ] }, { "uniprot_ac": "P48774", "gene_name": "Gstm5", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P48774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48774" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P48774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48774" } ] } ] }, { "uniprot_ac": "P57113", "gene_name": "Gstz1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P57113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P57113" } ] } ] }, { "uniprot_ac": "P78417", "gene_name": "GSTO1", "activity": [ { "ec_number": "1.20.4.2", "activity": "Methylarsonate + 2 glutathione = methylarsonite + glutathione disulfide + H(2)O.", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + dehydroascorbate = glutathione disulfide + ascorbate.", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P78417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78417" } ] } ] }, { "uniprot_ac": "Q01579", "gene_name": "Gstt1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q01579", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01579" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q01579", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01579" } ] } ] }, { "uniprot_ac": "Q03013", "gene_name": "GSTM4", "activity": [ { "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione.", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q03013", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03013" } ] } ] }, { "uniprot_ac": "Q16772", "gene_name": "GSTA3", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q16772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16772" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q16772", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16772" } ] } ] }, { "uniprot_ac": "Q16873", "gene_name": "LTC4S", "activity": [ { "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione.", "evidence": [ { "id": "Q16873", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16873" } ] }, { "ec_number": "2.5.1.-", "activity": "", "evidence": [ { "id": "Q16873", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16873" } ] }, { "ec_number": "4.4.1.20", "activity": "", "evidence": [ { "id": "Q16873", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16873" } ] } ] }, { "uniprot_ac": "Q4V8E6", "gene_name": "Gstt4", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q4V8E6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8E6" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q4V8E6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8E6" } ] } ] }, { "uniprot_ac": "Q5BK56", "gene_name": "Gstm4", "activity": [ { "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione.", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q5BK56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK56" } ] } ] }, { "uniprot_ac": "Q60860", "gene_name": "Ltc4s", "activity": [ { "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione.", "evidence": [ { "id": "Q60860", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60860" } ] }, { "ec_number": "2.5.1.-", "activity": "", "evidence": [ { "id": "Q60860", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60860" } ] }, { "ec_number": "4.4.1.20", "activity": "", "evidence": [ { "id": "Q60860", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q60860" } ] } ] }, { "uniprot_ac": "Q61133", "gene_name": "Gstt2", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q61133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61133" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q61133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61133" } ] } ] }, { "uniprot_ac": "Q64471", "gene_name": "Gstt1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q64471", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64471" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q64471", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64471" } ] } ] }, { "uniprot_ac": "Q6AXV9", "gene_name": "Gsto2", "activity": [ { "ec_number": "1.20.4.2", "activity": "Methylarsonate + 2 glutathione = methylarsonite + glutathione disulfide + H(2)O.", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + dehydroascorbate = glutathione disulfide + ascorbate.", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q6AXV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXV9" } ] } ] }, { "uniprot_ac": "Q6AXY0", "gene_name": "Gsta6", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q6AXY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXY0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6AXY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXY0" } ] } ] }, { "uniprot_ac": "Q6P8Q0", "gene_name": "Gm3776", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q6P8Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P8Q0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q6P8Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P8Q0" } ] } ] }, { "uniprot_ac": "Q7JYX0", "gene_name": "GstE14", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q7JYX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JYX0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q7JYX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7JYX0" } ] } ] }, { "uniprot_ac": "Q7K0B6", "gene_name": "GstT1", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.", "evidence": [ { "id": "Q7K0B6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K0B6" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q7K0B6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K0B6" } ] } ] }, { "uniprot_ac": "Q7RTV2", "gene_name": "GSTA5", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q7RTV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7RTV2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q7RTV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7RTV2" } ] } ] }, { "uniprot_ac": "Q80W21", "gene_name": "Gstm7", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q80W21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W21" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q80W21", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W21" } ] } ] }, { "uniprot_ac": "Q8K2Q2", "gene_name": "Gsto2", "activity": [ { "ec_number": "1.20.4.2", "activity": "Methylarsonate + 2 glutathione = methylarsonite + glutathione disulfide + H(2)O.", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + dehydroascorbate = glutathione disulfide + ascorbate.", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q8K2Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Q2" } ] } ] }, { "uniprot_ac": "Q8MRM0", "gene_name": "GstT4", "activity": [ { "ec_number": "1.11.1.9", "activity": "2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.", "evidence": [ { "id": "Q8MRM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MRM0" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q8MRM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8MRM0" } ] } ] }, { "uniprot_ac": "Q8R5I6", "gene_name": "Gstm4", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] }, { "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione.", "evidence": [ { "id": "Q8R5I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R5I6" } ] } ] }, { "uniprot_ac": "Q91VS7", "gene_name": "Mgst1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q91VS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VS7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q91VS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VS7" } ] } ] }, { "uniprot_ac": "Q925U2", "gene_name": "Ltc4s", "activity": [ { "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione.", "evidence": [ { "id": "Q925U2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q925U2" } ] }, { "ec_number": "2.5.1.-", "activity": "", "evidence": [ { "id": "Q925U2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q925U2" } ] }, { "ec_number": "4.4.1.20", "activity": "", "evidence": [ { "id": "Q925U2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q925U2" } ] } ] }, { "uniprot_ac": "Q99735", "gene_name": "MGST2", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione.", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q99735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99735" } ] } ] }, { "uniprot_ac": "Q99L20", "gene_name": "Gstt3", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q99L20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99L20" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q99L20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99L20" } ] } ] }, { "uniprot_ac": "Q9CPU4", "gene_name": "Mgst3", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q9CPU4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CPU4" } ] } ] }, { "uniprot_ac": "Q9D4P7", "gene_name": "Gstt4", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9D4P7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4P7" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9D4P7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4P7" } ] } ] }, { "uniprot_ac": "Q9DCM2", "gene_name": "Gstk1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9DCM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCM2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9DCM2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCM2" } ] } ] }, { "uniprot_ac": "Q9H4Y5", "gene_name": "GSTO2", "activity": [ { "ec_number": "1.20.4.2", "activity": "Methylarsonate + 2 glutathione = methylarsonite + glutathione disulfide + H(2)O.", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + dehydroascorbate = glutathione disulfide + ascorbate.", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9H4Y5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H4Y5" } ] } ] }, { "uniprot_ac": "Q9JHF3", "gene_name": "Ptges", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q9JHF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF3" } ] }, { "ec_number": "5.3.99.3", "activity": "(5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-11-alpha,15-dihydroxy-9-oxoprosta-5,13-dienoate.", "evidence": [ { "id": "Q9JHF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF3" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9JHF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF3" } ] }, { "ec_number": "5.3.99.3", "activity": "", "evidence": [ { "id": "Q9JHF3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF3" } ] } ] }, { "uniprot_ac": "Q9JHF7", "gene_name": "Hpgds", "activity": [ { "ec_number": "5.3.99.2", "activity": "(5Z,13E,15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E,15S)-9-alpha,15-dihydroxy-11-oxoprosta-5,13-dienoate.", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "Q9JHF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JHF7" } ] } ] }, { "uniprot_ac": "Q9JM51", "gene_name": "Ptges", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q9JM51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JM51" } ] }, { "ec_number": "5.3.99.3", "activity": "(5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-11-alpha,15-dihydroxy-9-oxoprosta-5,13-dienoate.", "evidence": [ { "id": "Q9JM51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JM51" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9JM51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JM51" } ] }, { "ec_number": "5.3.99.3", "activity": "", "evidence": [ { "id": "Q9JM51", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JM51" } ] } ] }, { "uniprot_ac": "Q9QX69", "gene_name": "Lancl1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9QX69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QX69" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9QX69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QX69" } ] } ] }, { "uniprot_ac": "Q9VG93", "gene_name": "GstD7", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9VG93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG93" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG93" } ] } ] }, { "uniprot_ac": "Q9VG94", "gene_name": "GstD6", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9VG94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG94" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG94" } ] } ] }, { "uniprot_ac": "Q9VG95", "gene_name": "GstD5", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9VG95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG95" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG95" } ] } ] }, { "uniprot_ac": "Q9VG96", "gene_name": "GstD4", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9VG96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG96" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG96", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG96" } ] } ] }, { "uniprot_ac": "Q9VG98", "gene_name": "GstD2", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9VG98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG98" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9VG98", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VG98" } ] } ] }, { "uniprot_ac": "Q9VHD2", "gene_name": "GstZ2", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9VHD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD2" } ] } ] }, { "uniprot_ac": "Q9VHD3", "gene_name": "GstZ1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9VHD3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHD3" } ] } ] }, { "uniprot_ac": "Q9WVL0", "gene_name": "Gstz1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "Q9WVL0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVL0" } ] } ] }, { "uniprot_ac": "Q9Y2Q3", "gene_name": "GSTK1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9Y2Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Y2Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q3" } ] } ] }, { "uniprot_ac": "Q9Z1B2", "gene_name": "Gstm5", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9Z1B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1B2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Z1B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1B2" } ] } ] }, { "uniprot_ac": "Q9Z339", "gene_name": "Gsto1", "activity": [ { "ec_number": "1.20.4.2", "activity": "Methylarsonate + 2 glutathione = methylarsonite + glutathione disulfide + H(2)O.", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.8.5.1", "activity": "2 glutathione + dehydroascorbate = glutathione disulfide + ascorbate.", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione.", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9Z339", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z339" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ] }