{ "uniprot_canonical_ac": "A2AVL6-1", "uniprot_ac": "A2AVL6", "uniprot_id": "A2AVL6_MOUSE", "mass": { "chemical_mass": 35073.0, "monoisotopic_mass": 35073.0 }, "refseq": { "ac": "NP_666661", "name": "olfactory receptor 1314", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666661" }, "gene_names": [ { "name": "Olfr1314", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2AVL6", "id": "A2AVL6" }, { "name": "MOR245-2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666661", "id": "NP_666661" }, { "name": "Olfr1314", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666661", "id": "NP_666661" }, { "name": "Olfr1316", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2AVL6", "id": "A2AVL6" } ], "protein_names": [ { "name": "Olfactory receptor", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2AVL6#names_and_taxonomy", "id": "A2AVL6" }, { "name": "olfactory receptor 1314", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666661", "id": "NP_666661" }, { "name": "olfactory receptor MOR245-2; GA_x6K02T2Q125-73139026-73138088", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666661", "id": "NP_666661" } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_666661", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666661" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2AVL6", "url": "https://www.uniprot.org/uniprot/A2AVL6" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Olfr1314", "url": "https://www.uniprot.org/uniprot/A2AVL6", "locus": { "chromosome": "2", "start_pos": 112096781, "end_pos": 112089786, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000074945", "url": "https://www.ensembl.org/id/ENSMUSG00000074945" } ] } } ], "crossref": [ { "id": "ENSMUSG00000074945", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000074945", "database": "Bgee" }, { "id": "258442", "url": "https://www.ncbi.nlm.nih.gov/gene/258442", "database": "GeneID" }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro" }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro" }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro" }, { "id": "mmu:258442", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258442", "database": "KEGG Pathway" }, { "id": "3031148", "url": "http://www.informatics.jax.org/marker/MGI:3031148", "database": "MGI" }, { "id": "NSWRMEV", "url": "https://omabrowser.org/oma/group/NSWRMEV/", "database": "OMA" }, { "id": "976268at2759", "url": "http://www.orthodb.org/?query=976268at2759", "database": "OrthoDB" }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam" }, { "id": "NP_666661", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666661", "database": "RefSeq" }, { "id": "A2AVL6", "url": "https://www.uniprot.org/uniprot/A2AVL6", "database": "UniProtKB" }, { "id": "A2AVL6-1", "url": "https://www.uniprot.org/uniprot/A2AVL6-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MEGTNRSVVSEFMFVGLTNSWKMQVLLFVFASVFYMASMMGNSLIIFTVASDPHLHSLMYFLLANLSFIDLGVSCVTCPKMIYDLFRKHKVISFRGCITQIFFIHVIGGVEVVLLIGMAYDRYVAICKPLHYLTIMNAKMCIFILVSAWVVGLMHSLVQFVYIVNLPFCGPNILDSFYCDLPRFIRLACVDTNQLELMVSANSGFISVGSFFILVISYIVIIVTVQKHSSSGSSKALSTLSAHISVVVLFFGPLIFVYTWPSPSTHLDKYLAIFDAVGTPFLNPVIYTLRNQDMKTAMKRVCRQLLKYGKIS", "length": 312, "header": "tr|A2AVL6-1|A2AVL6_MOUSE Isoform 1 of Olfactory receptor OS=Mus musculus OX=10090 GN=Olfr1314 PE=3 SV=1 CANONICAL=A2AVL6-1" }, "isoforms": [ { "isoform_ac": "A2AVL6-1", "url": "https://www.uniprot.org/uniprot/A2AVL6#A2AVL6-1", "sequence": { "sequence": "MEGTNRSVVSEFMFVGLTNSWKMQVLLFVFASVFYMASMMGNSLIIFTVASDPHLHSLMYFLLANLSFIDLGVSCVTCPKMIYDLFRKHKVISFRGCITQIFFIHVIGGVEVVLLIGMAYDRYVAICKPLHYLTIMNAKMCIFILVSAWVVGLMHSLVQFVYIVNLPFCGPNILDSFYCDLPRFIRLACVDTNQLELMVSANSGFISVGSFFILVISYIVIIVTVQKHSSSGSSKALSTLSAHISVVVLFFGPLIFVYTWPSPSTHLDKYLAIFDAVGTPFLNPVIYTLRNQDMKTAMKRVCRQLLKYGKIS", "length": 312, "header": "tr|A2AVL6-1|A2AVL6_MOUSE Isoform 1 of Olfactory receptor OS=Mus musculus OX=10090 GN=Olfr1314 PE=3 SV=1 CANONICAL=A2AVL6-1" }, "locus": { "chromosome": "2", "start_pos": 111923044, "end_pos": 111922109, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000207976", "url": "https://www.ensembl.org/id/ENSMUST00000207976" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000146418", "url": "https://www.ensembl.org/id/ENSMUSP00000146418" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "mmu:258442", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258442", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A2AVL6", "url": "https://www.uniprot.org/uniprot/A2AVL6" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A2AVL6", "url": "https://www.uniprot.org/uniprot/A2AVL6" } ], "pmid": "14611657" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A2AVL6", "url": "https://www.uniprot.org/uniprot/A2AVL6" } ], "pmid": "" }, { "name": "integral component of membrane", "id": "GO:0016021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "evidence": [ { "database": "UniProtKB", "id": "A2AVL6", "url": "https://www.uniprot.org/uniprot/A2AVL6" } ], "pmid": "14611657" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "A2AVL6", "url": "https://www.uniprot.org/uniprot/A2AVL6" } ], "pmid": "14611657" }, { "name": "sensory perception of smell", "id": "GO:0007608", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608", "evidence": [ { "database": "UniProtKB", "id": "A2AVL6", "url": "https://www.uniprot.org/uniprot/A2AVL6" } ], "pmid": "14611657" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" }, { "start_pos": 65, "end_pos": 67, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "synthesized_glycans": [], "cluster_types": [] }