{ "uniprot_canonical_ac": "A2ARZ0-1", "uniprot_ac": "A2ARZ0", "uniprot_id": "A2ARZ0_MOUSE", "mass": { "chemical_mass": 34919.0, "monoisotopic_mass": 34919.0 }, "refseq": { "ac": "NP_667227", "name": "olfactory receptor 1049", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667227" }, "gene_names": [ { "name": "Olfr1049", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2ARZ0", "id": "A2ARZ0" }, { "name": "MOR187-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667227", "id": "NP_667227" }, { "name": "Olfr1049", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667227", "id": "NP_667227" }, { "name": "Olfr1051", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2ARZ0", "id": "A2ARZ0" } ], "protein_names": [ { "name": "Olfactory receptor", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2ARZ0#names_and_taxonomy", "id": "A2ARZ0" }, { "name": "olfactory receptor 1049", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667227", "id": "NP_667227" }, { "name": "olfactory receptor MOR187-1; GA_x6K02T2Q125-47735396-47734470", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667227", "id": "NP_667227" } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_667227", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667227" } ] }, { "annotation": "This odorant receptor, Olfr1049, responds to the odorant bourgeonal in vivo.", "evidence": [ { "database": "RefSeq", "id": "NP_667227", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667227" }, { "database": "PubMed", "id": "32061665", "url": "https://glygen.org/publication/PubMed/32061665" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2ARZ0", "url": "https://www.uniprot.org/uniprot/A2ARZ0" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Olfr1049", "url": "https://www.uniprot.org/uniprot/A2ARZ0", "locus": { "chromosome": "2", "start_pos": 86258328, "end_pos": 86254357, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000075194", "url": "https://www.ensembl.org/id/ENSMUSG00000075194" } ] } } ], "crossref": [ { "id": "ENSMUSG00000075194", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000075194", "database": "Bgee" }, { "id": "259018", "url": "https://www.ncbi.nlm.nih.gov/gene/259018", "database": "GeneID" }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro" }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro" }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro" }, { "id": "mmu:259018", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:259018", "database": "KEGG Pathway" }, { "id": "3030883", "url": "http://www.informatics.jax.org/marker/MGI:3030883", "database": "MGI" }, { "id": "NICNIYI", "url": "https://omabrowser.org/oma/group/NICNIYI/", "database": "OMA" }, { "id": "1091850at2759", "url": "http://www.orthodb.org/?query=1091850at2759", "database": "OrthoDB" }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam" }, { "id": "NP_667227", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667227", "database": "RefSeq" }, { "id": "A2ARZ0", "url": "https://www.uniprot.org/uniprot/A2ARZ0", "database": "UniProtKB" }, { "id": "A2ARZ0-1", "url": "https://www.uniprot.org/uniprot/A2ARZ0-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MGQPNITMPTEFILMGVTQTAELKLPLFAVFLTIYAITVVGNLGMIILTKLDSRLQTPMYFFIRHLAFIDLGNSTAICPKMLVNFVVDKNNITYYACATQMACFILFIVSELSILSSMAYDRYVAICNPLLYSAIMSQRRCQVLIGIPYLYSIFQALLFPIRYFTLSFCGANIISHFYCDVVPLLPLICSHVEETELLTILFSAFNLISSLVVVLLSYMLILLTIFQMRSAEGRKKAFSTCGSHLTVVVVFYGSLLFMYVQPKSAHSFEYDKAASVFYTLVIPMLNPLIYSLRNKEVKNAFHRVFKNL", "length": 308, "header": "tr|A2ARZ0-1|A2ARZ0_MOUSE Isoform 1 of Olfactory receptor OS=Mus musculus OX=10090 GN=Olfr1049 PE=3 SV=1 CANONICAL=A2ARZ0-1" }, "isoforms": [ { "isoform_ac": "A2ARZ0-1", "url": "https://www.uniprot.org/uniprot/A2ARZ0#A2ARZ0-1", "sequence": { "sequence": "MGQPNITMPTEFILMGVTQTAELKLPLFAVFLTIYAITVVGNLGMIILTKLDSRLQTPMYFFIRHLAFIDLGNSTAICPKMLVNFVVDKNNITYYACATQMACFILFIVSELSILSSMAYDRYVAICNPLLYSAIMSQRRCQVLIGIPYLYSIFQALLFPIRYFTLSFCGANIISHFYCDVVPLLPLICSHVEETELLTILFSAFNLISSLVVVLLSYMLILLTIFQMRSAEGRKKAFSTCGSHLTVVVVFYGSLLFMYVQPKSAHSFEYDKAASVFYTLVIPMLNPLIYSLRNKEVKNAFHRVFKNL", "length": 308, "header": "tr|A2ARZ0-1|A2ARZ0_MOUSE Isoform 1 of Olfactory receptor OS=Mus musculus OX=10090 GN=Olfr1049 PE=3 SV=1 CANONICAL=A2ARZ0-1" }, "locus": { "chromosome": "2", "start_pos": 86086035, "end_pos": 86085112, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000216185", "url": "https://www.ensembl.org/id/ENSMUST00000216185" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000149360", "url": "https://www.ensembl.org/id/ENSMUSP00000149360" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Modulation of the combinatorial code of odorant receptor response patterns in odorant mixtures.", "journal": "Molecular and cellular neurosciences", "date": "2020", "authors": "de March CA, Titlow WB, Sengoku T, Breheny P, Matsunami H, McClintock TS", "evidence": [ { "database": "RefSeq", "id": "NP_667227", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667227" } ], "reference": [ { "type": "PubMed", "id": "32061665", "url": "https://glygen.org/publication/PubMed/32061665" } ] } ], "pathway": [ { "id": "mmu:259018", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:259018", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D4ACZ8-1", "protein_name": "Olfactory receptor", "gene_name": "Olr488", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAQPNVTMPTEFILMGVTQTAVLKLPLFAVFLAVYAITVVGNLGMIILTKLDSRLHTPMYFFIRHLAFIDLGNSTTICPKMLVNFVVDQNTITYYACATQMACFIMFIVSELTVLSSMAYDRYVAICNPLLYSAIMSQRRCQVLVGIPYLYSTFQALLFPIKYFTSSFCGANVISHFYCDVVPLLPLICSHVEETELLTILFSAFNLISSLLVILLSYMLILLTICRMRSAEGRKKALSTCGSHLTVVVVFYGSLLFMYVQPKSAHSFEYDKMASVFYTLVIPMLNPLIYSLRNKEVKNAFHRICKNI", "length": 308 }, "evidence": [ { "id": "77387", "url": "http://www.informatics.jax.org/homology/77387", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q7TR76-1", "protein_name": "Olfactory receptor", "gene_name": "Olfr1051", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGQPNITMPTEFILMGVTQSAELKLPLFAVFLAIYAITVVGNLGMIILTKLDSRLQTPMYFFIRHLAFIDLGNSTAICPKMLVNFVVDKNTITYYACATQMACFILFIVSELSILSSMAYDRYVAICNPLLYSAIMSQRRCQVLIGIPYLYSIFQALLFPIRYFTLSFCGANVISHFYCDVVPLLPLICSHVEETELLTILFSAFNLISSLVVVLLSYMLILLTIFRMRSAEGRKKAFSTCGSHLTVVVVFYGSLLFMYVQPKSAHSFEYDKAASVFYTLVIPMLNPLIYSLRNKEVKNAFHRVFKNL", "length": 308 }, "evidence": [ { "id": "77387", "url": "http://www.informatics.jax.org/homology/77387", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A2ARZ0", "url": "https://www.uniprot.org/uniprot/A2ARZ0" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A2ARZ0", "url": "https://www.uniprot.org/uniprot/A2ARZ0" } ], "pmid": "14611657" }, { "name": "odorant binding", "id": "GO:0005549", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005549", "evidence": [ { "database": "UniProtKB", "id": "A2ARZ0", "url": "https://www.uniprot.org/uniprot/A2ARZ0" } ], "pmid": "21873635" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A2ARZ0", "url": "https://www.uniprot.org/uniprot/A2ARZ0" } ], "pmid": "" }, { "name": "integral component of membrane", "id": "GO:0016021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "evidence": [ { "database": "UniProtKB", "id": "A2ARZ0", "url": "https://www.uniprot.org/uniprot/A2ARZ0" } ], "pmid": "14611657" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "A2ARZ0", "url": "https://www.uniprot.org/uniprot/A2ARZ0" } ], "pmid": "14611657" }, { "name": "sensory perception of smell", "id": "GO:0007608", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608", "evidence": [ { "database": "UniProtKB", "id": "A2ARZ0", "url": "https://www.uniprot.org/uniprot/A2ARZ0" } ], "pmid": "14611657" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" }, { "start_pos": 73, "end_pos": 75, "annotation": "n_glycosylation_sequon" }, { "start_pos": 91, "end_pos": 93, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ] }