{ "uniprot_canonical_ac": "A2AM29-1", "uniprot_ac": "A2AM29", "uniprot_id": "AF9_MOUSE", "mass": { "chemical_mass": 63375.0, "monoisotopic_mass": 63375.0 }, "refseq": { "ac": "NP_084207", "name": "protein AF-9 isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207" }, "gene_names": [ { "name": "Mllt3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29" }, { "name": "2210011H10Rik; 2610012I03Rik; 3830408D16Rik; Af9; D4Ertd321e", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602", "id": "NP_081602" }, { "name": "Af9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29" }, { "name": "Mllt3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602", "id": "NP_081602" } ], "protein_names": [ { "name": "Protein AF-9", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2AM29#names_and_taxonomy", "id": "A2AM29" }, { "name": "Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein homolog", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2AM29#names_and_taxonomy", "id": "A2AM29" }, { "name": "protein AF-9 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602", "id": "NP_081602" }, { "name": "protein AF-9 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207", "id": "NP_084207" }, { "name": "protein AF-9; myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein homolog; myeloid/lymphoid or mixed lineage-leukemia translocation to 3 homolog; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207", "id": "NP_084207" } ], "function": [ { "annotation": "Af9 gene is required for normal embryogenesis in mice by controlling pattern formation, apparently via control of Hox gene regulation", "evidence": [ { "database": "RefSeq", "id": "NP_084207", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207" }, { "database": "PubMed", "id": "12242306", "url": "https://glygen.org/publication/PubMed/12242306" }, { "database": "RefSeq", "id": "NP_081602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602" } ] }, { "annotation": "CRISPR Gene Editing of Murine Blood Stem and Progenitor Cells Induces MLL-AF9 Chromosomal Translocation and MLL-AF9 Leukaemogenesis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_084207", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207" }, { "database": "PubMed", "id": "32549410", "url": "https://glygen.org/publication/PubMed/32549410" }, { "database": "RefSeq", "id": "NP_081602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602" } ] }, { "annotation": "Chromatin reader component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA. Specifically recognizes and binds acylated histone H3, with a preference for histone H3 that is crotonylated. Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors. Recognizes and binds histone H3 crotonylated at 'Lys-9' (H3K9cr), and with slightly lower affinity histone H3 crotonylated at 'Lys-18' (H3K18cr). Also recognizes and binds histone H3 acetylated and butyrylated at 'Lys-9' (H3K9ac and H3K9bu, respectively), but with lower affinity than crotonylated histone H3. In the SEC complex, MLLT3 is required to recruit the complex to crotonylated histones. Recruitment of the SEC complex to crotonylated histones promotes recruitment of DOT1L on active chromatin to deposit histone H3 'Lys-79' methylation (H3K79me). Plays a key role in hematopoietic stem cell (HSC) maintenance by preserving, rather than confering, HSC stemness. Acts by binding to the transcription start site of active genes in HSCs and sustaining level of H3K79me2, probably by recruiting DOT1L.", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29#function" }, { "database": "PubMed", "id": "P42568", "url": "https://glygen.org/publication/PubMed/P42568" } ] }, { "annotation": "Heritable genetic background alters survival and phenotype of Mll-AF9-induced leukemias.", "evidence": [ { "database": "RefSeq", "id": "NP_084207", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207" }, { "database": "PubMed", "id": "32768438", "url": "https://glygen.org/publication/PubMed/32768438" }, { "database": "RefSeq", "id": "NP_081602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602" } ] }, { "annotation": "The Transcriptional Coactivator, ALL1-Fused Gene From Chromosome 9, Simultaneously Sustains Hypoxia Tolerance and Metabolic Advantages in Liver Cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_084207", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207" }, { "database": "PubMed", "id": "33928666", "url": "https://glygen.org/publication/PubMed/33928666" }, { "database": "RefSeq", "id": "NP_081602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Mllt3", "url": "https://www.uniprot.org/uniprot/A2AM29", "locus": { "chromosome": "4", "start_pos": 88033364, "end_pos": 87769925, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000028496", "url": "https://www.ensembl.org/id/ENSMUSG00000028496" } ] } } ], "crossref": [ { "id": "ENSMUSG00000028496", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000028496", "database": "Bgee" }, { "id": "70122", "url": "https://www.ncbi.nlm.nih.gov/gene/70122", "database": "GeneID" }, { "id": "A2AM29", "url": "https://www.ebi.ac.uk/intact/interactors/id:A2AM29*", "database": "IntAct" }, { "id": "IPR005033", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005033", "database": "InterPro" }, { "id": "IPR038704", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038704", "database": "InterPro" }, { "id": "IPR040930", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040930", "database": "InterPro" }, { "id": "mmu:70122", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:70122", "database": "KEGG Pathway" }, { "id": "1917372", "url": "http://www.informatics.jax.org/marker/MGI:1917372", "database": "MGI" }, { "id": "MSKEPKA", "url": "https://omabrowser.org/oma/group/MSKEPKA/", "database": "OMA" }, { "id": "727038at2759", "url": "http://www.orthodb.org/?query=727038at2759", "database": "OrthoDB" }, { "id": "PTHR23195", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23195", "database": "PANTHER" }, { "id": "PF03366", "url": "http://pfam.xfam.org/family/PF03366", "database": "Pfam" }, { "id": "PF17793", "url": "http://pfam.xfam.org/family/PF17793", "database": "Pfam" }, { "id": "PR_A2AM29", "url": "http://purl.obolibrary.org/obo/PR_A2AM29", "database": "PRO" }, { "id": "R-MMU-112382", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-112382", "database": "Reactome" }, { "id": "R-MMU-674695", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-674695", "database": "Reactome" }, { "id": "R-MMU-75955", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-75955", "database": "Reactome" }, { "id": "NP_081602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602", "database": "RefSeq" }, { "id": "NP_084207", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207", "database": "RefSeq" }, { "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29", "database": "UniProtKB" }, { "id": "A2AM29-1", "url": "https://www.uniprot.org/uniprot/A2AM29-1", "database": "UniProtKB" }, { "id": "E9PXP8", "url": "https://www.uniprot.org/uniprot/E9PXP8", "database": "UniProtKB" }, { "id": "E9PXP8-1", "url": "https://www.uniprot.org/uniprot/E9PXP8-1", "database": "UniProtKB" }, { "id": "E9Q3B8", "url": "https://www.uniprot.org/uniprot/E9Q3B8", "database": "UniProtKB" }, { "id": "E9Q3B8-1", "url": "https://www.uniprot.org/uniprot/E9Q3B8-1", "database": "UniProtKB" }, { "id": "Q3UIA3", "url": "https://www.uniprot.org/uniprot/Q3UIA3", "database": "UniProtKB" }, { "id": "Q3UIA3-1", "url": "https://www.uniprot.org/uniprot/Q3UIA3-1", "database": "UniProtKB" }, { "id": "Q9D2P1", "url": "https://www.uniprot.org/uniprot/Q9D2P1", "database": "UniProtKB" }, { "id": "Q9D2P1-1", "url": "https://www.uniprot.org/uniprot/Q9D2P1-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPKKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKADSNLLTVTSGQQDKKAPSKRPPASDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSMLPPFDDIVDPNDSDVEENMSSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS", "length": 569, "header": "sp|A2AM29-1|AF9_MOUSE Isoform 1 of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1" }, "isoforms": [ { "isoform_ac": "A2AM29-1", "url": "https://www.uniprot.org/uniprot/A2AM29#A2AM29-1", "sequence": { "sequence": "MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPKKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKADSNLLTVTSGQQDKKAPSKRPPASDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSMLPPFDDIVDPNDSDVEENMSSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS", "length": 569, "header": "sp|A2AM29-1|AF9_MOUSE Isoform 1 of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1" }, "locus": { "chromosome": "4", "start_pos": 87951332, "end_pos": 87692255, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000078090", "url": "https://www.ensembl.org/id/ENSMUST00000078090" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000077232", "url": "https://www.ensembl.org/id/ENSMUSP00000077232" } ] } }, { "isoform_ac": "E9PXP8-1", "url": "https://www.uniprot.org/uniprot/A2AM29#E9PXP8-1", "sequence": { "sequence": "MTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS", "length": 54, "header": "tr|E9PXP8-1|E9PXP8_MOUSE Computationally mapped isoform of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=4 SV=1 CANONICAL=A2AM29-1" }, "locus": { "chromosome": "4", "start_pos": 87700556, "end_pos": 87692255, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000148059", "url": "https://www.ensembl.org/id/ENSMUST00000148059" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000131095", "url": "https://www.ensembl.org/id/ENSMUSP00000131095" } ] } }, { "isoform_ac": "E9Q3B8-1", "url": "https://www.uniprot.org/uniprot/A2AM29#E9Q3B8-1", "sequence": { "sequence": "MCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRAWTEWRWLRSGC", "length": 73, "header": "tr|E9Q3B8-1|E9Q3B8_MOUSE Computationally mapped isoform of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1" }, "locus": { "chromosome": "4", "start_pos": 87950876, "end_pos": 87929910, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000142454", "url": "https://www.ensembl.org/id/ENSMUST00000142454" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000127376", "url": "https://www.ensembl.org/id/ENSMUSP00000127376" } ] } }, { "isoform_ac": "Q3UIA3-1", "url": "https://www.uniprot.org/uniprot/A2AM29#Q3UIA3-1", "sequence": { "sequence": "MKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS", "length": 162, "header": "tr|Q3UIA3-1|AF9_MOUSE Computationally mapped isoform of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1" }, "locus": { "chromosome": "4", "start_pos": 87710202, "end_pos": 87692255, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000149357", "url": "https://www.ensembl.org/id/ENSMUST00000149357" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000128366", "url": "https://www.ensembl.org/id/ENSMUSP00000128366" } ] } }, { "isoform_ac": "Q9D2P1-1", "url": "https://www.uniprot.org/uniprot/A2AM29#Q9D2P1-1", "sequence": { "sequence": "MKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS", "length": 138, "header": "tr|Q9D2P1-1|Q9D2P1_MOUSE Computationally mapped isoform of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1" }, "locus": { "chromosome": "4", "start_pos": 87710202, "end_pos": 87692255, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000126353", "url": "https://www.ensembl.org/id/ENSMUST00000126353" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000129523", "url": "https://www.ensembl.org/id/ENSMUSP00000129523" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 289, "end_pos": 289, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ] }, { "start_pos": 295, "end_pos": 295, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ] }, { "start_pos": 413, "end_pos": 413, "kinase_uniprot_canonical_ac": "Q3UD01-1", "kinase_gene_name": "Atxn7l3b", "residue": "Ser", "comment": "", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" }, { "database": "iPTMnet", "id": "A2AM29", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A2AM29" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "start_pos": 413, "end_pos": 413, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "start_pos": 420, "end_pos": 420, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ] }, { "start_pos": 484, "end_pos": 484, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ] } ], "glycation": [], "keywords": [], "publication": [ { "title": "The polycomb protein MPc3 interacts with AF9, an MLL fusion partner in t(9;11)(p22;q23) acute leukemias.", "journal": "Oncogene", "date": "2001", "authors": "Gould G.C.D., Hemenway C.S., de Erkenez A.C.", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "reference": [ { "type": "PubMed", "id": "11439343", "url": "https://glygen.org/publication/PubMed/11439343" } ] }, { "title": "Mouse Af9 is a controller of embryo patterning, like Mll, whose human homologue fuses with Af9 after chromosomal translocation in leukemia.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Collins EC, Appert A, Ariza-McNaughton L, Pannell R, Yamada Y, Rabbitts TH", "evidence": [ { "database": "RefSeq", "id": "NP_084207", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207" }, { "database": "RefSeq", "id": "NP_081602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602" } ], "reference": [ { "type": "PubMed", "id": "12242306", "url": "https://glygen.org/publication/PubMed/12242306" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" }, { "database": "iPTMnet", "id": "A2AM29", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A2AM29" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "CRISPR Gene Editing of Murine Blood Stem and Progenitor Cells Induces MLL-AF9 Chromosomal Translocation and MLL-AF9 Leukaemogenesis.", "journal": "International journal of molecular sciences", "date": "2020", "authors": "Sarrou E, Richmond L, Carmody RJ, Gibson B, Keeshan K", "evidence": [ { "database": "RefSeq", "id": "NP_084207", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207" }, { "database": "RefSeq", "id": "NP_081602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602" } ], "reference": [ { "type": "PubMed", "id": "32549410", "url": "https://glygen.org/publication/PubMed/32549410" } ] }, { "title": "Heritable genetic background alters survival and phenotype of Mll-AF9-induced leukemias.", "journal": "Experimental hematology", "date": "2020", "authors": "Young K, Loberg MA, Eudy E, Schwartz LS, Mujica KD, Trowbridge JJ", "evidence": [ { "database": "RefSeq", "id": "NP_084207", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207" }, { "database": "RefSeq", "id": "NP_081602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602" } ], "reference": [ { "type": "PubMed", "id": "32768438", "url": "https://glygen.org/publication/PubMed/32768438" } ] }, { "title": "The Transcriptional Coactivator, ALL1-Fused Gene From Chromosome 9, Simultaneously Sustains Hypoxia Tolerance and Metabolic Advantages in Liver Cancer.", "journal": "Hepatology (Baltimore, Md.)", "date": "2021", "authors": "Yu H, He J, Liu W, Feng S, Gao L, Xu Y, Zhang Y, Hou X, Zhou Y, Yang L, Wang X", "evidence": [ { "database": "RefSeq", "id": "NP_081602", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602" }, { "database": "RefSeq", "id": "NP_084207", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207" } ], "reference": [ { "type": "PubMed", "id": "33928666", "url": "https://glygen.org/publication/PubMed/33928666" } ] } ], "pathway": [ { "id": "mmu:70122", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:70122", "resource": "KEGG Pathway" }, { "id": "R-MMU-112382", "name": "Formation of RNA Pol II elongation complex", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-112382", "resource": "Reactome", "description": "Formation of RNA Pol II elongation complex" }, { "id": "R-MMU-674695", "name": "RNA Polymerase II Pre-transcription Events", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-674695", "resource": "Reactome", "description": "RNA Polymerase II Pre-transcription Events" }, { "id": "R-MMU-75955", "name": "RNA Polymerase II Transcription Elongation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-75955", "resource": "Reactome", "description": "RNA Polymerase II Transcription Elongation" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2QC34-1", "protein_name": "MLLT3, super elongation complex subunit", "gene_name": "Mllt3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MIVFMKRSSKPLLPSHHCLSVLQEEPKKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKADSNLLTVTSAQQDKKAPSKRPPVSDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSTLPPFDDIVDPNDSDVEENMSSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS", "length": 500 }, "evidence": [ { "id": "A2AM29", "url": "https://omabrowser.org/oma/group/A2AM29/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P42568-1", "protein_name": "Protein AF-9", "gene_name": "MLLT3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKAPSKRPPISDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSTLPPFDDIVDPNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS", "length": 568 }, "evidence": [ { "id": "37933", "url": "http://www.informatics.jax.org/homology/37933", "database": "MGI" }, { "id": "A2AM29", "url": "https://omabrowser.org/oma/group/A2AM29/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" }, { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" }, { "name": "histone binding", "id": "GO:0042393", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042393", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" }, { "name": "lysine-acetylated histone binding", "id": "GO:0070577", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070577", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" }, { "name": "modification-dependent protein binding", "id": "GO:0140030", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140030", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" }, { "name": "transcription elongation factor complex", "id": "GO:0008023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008023", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" }, { "name": "chromosome", "id": "GO:0005694", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005694", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "negative regulation of canonical Wnt signaling pathway", "id": "GO:0090090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090090", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" }, { "name": "hematopoietic stem cell differentiation", "id": "GO:0060218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060218", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" }, { "name": "positive regulation of transcription, DNA-templated", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" }, { "name": "anterior/posterior pattern specification", "id": "GO:0009952", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009952", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "12242306" }, { "name": "positive regulation of Wnt signaling pathway, planar cell polarity pathway", "id": "GO:2000096", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000096", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" }, { "name": "segment specification", "id": "GO:0007379", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007379", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "12242306" }, { "name": "regulation of stem cell division", "id": "GO:2000035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000035", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" }, { "name": "gene expression", "id": "GO:0010467", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010467", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "20427473" }, { "name": "regulation of chromatin organization", "id": "GO:1902275", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902275", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" }, { "name": "regulation of transcription, DNA-templated", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "A2AM29", "url": "https://www.uniprot.org/uniprot/A2AM29" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 143, "end_pos": 145, "annotation": "n_glycosylation_sequon" }, { "start_pos": 226, "end_pos": 228, "annotation": "n_glycosylation_sequon" }, { "start_pos": 363, "end_pos": 365, "annotation": "n_glycosylation_sequon" }, { "start_pos": 370, "end_pos": 372, "annotation": "n_glycosylation_sequon" }, { "start_pos": 428, "end_pos": 430, "annotation": "n_glycosylation_sequon" }, { "start_pos": 541, "end_pos": 543, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ] }