{ "uniprot_canonical_ac": "A2ALK8-1", "uniprot_ac": "A2ALK8", "uniprot_id": "PTN3_MOUSE", "mass": { "chemical_mass": 103896.0, "monoisotopic_mass": 103896.0 }, "refseq": { "ac": "NP_035337", "name": "tyrosine-protein phosphatase non-receptor type 3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035337" }, "gene_names": [ { "name": "Ptpn3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2ALK8", "id": "A2ALK8" }, { "name": "9530011I20Rik; PTP-H1; PTPCL", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035337", "id": "NP_035337" }, { "name": "Ptpn3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035337", "id": "NP_035337" } ], "protein_names": [ { "name": "Tyrosine-protein phosphatase non-receptor type 3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2ALK8#names_and_taxonomy", "id": "A2ALK8" }, { "name": "3.1.3.48", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2ALK8#names_and_taxonomy", "id": "A2ALK8" }, { "name": "protein-tyrosine phosphatase H1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035337", "id": "NP_035337" }, { "name": "tyrosine-protein phosphatase non-receptor type 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035337", "id": "NP_035337" } ], "function": [ { "annotation": "May act at junctions between the membrane and the cytoskeleton.", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8#function" } ] }, { "annotation": "P38gamma Mitogen-activated protein kinase signals through phosphorylating its phosphatase PTPH1 in regulating ras protein oncogenesis and stress response.", "evidence": [ { "database": "RefSeq", "id": "NP_035337", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035337" }, { "database": "PubMed", "id": "22730326", "url": "https://glygen.org/publication/PubMed/22730326" } ] }, { "annotation": "PTP-H1 has a role in modulating GHR signaling and systemic growth through insulin-like growth factor 1 secretion", "evidence": [ { "database": "RefSeq", "id": "NP_035337", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035337" }, { "database": "PubMed", "id": "17921143", "url": "https://glygen.org/publication/PubMed/17921143" } ] }, { "annotation": "PTPN3 and PTPN4 are dispensable for TCR signal transduction.", "evidence": [ { "database": "RefSeq", "id": "NP_035337", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035337" }, { "database": "PubMed", "id": "19107198", "url": "https://glygen.org/publication/PubMed/19107198" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ptpn3", "url": "https://www.uniprot.org/uniprot/A2ALK8", "locus": { "chromosome": "4", "start_pos": 57301837, "end_pos": 57190841, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000038764", "url": "https://www.ensembl.org/id/ENSMUSG00000038764" } ] } } ], "crossref": [ { "id": "ENSMUSG00000038764", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000038764", "database": "Bgee" }, { "id": "cd13189", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd13189", "database": "CDD" }, { "id": "cd14473", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14473", "database": "CDD" }, { "id": "545622", "url": "https://www.ncbi.nlm.nih.gov/gene/545622", "database": "GeneID" }, { "id": "A2ALK8", "url": "https://www.ebi.ac.uk/intact/interactors/id:A2ALK8*", "database": "IntAct" }, { "id": "IPR000242", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000242", "database": "InterPro" }, { "id": "IPR000299", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000299", "database": "InterPro" }, { "id": "IPR000387", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000387", "database": "InterPro" }, { "id": "IPR000798", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000798", "database": "InterPro" }, { "id": "IPR001478", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001478", "database": "InterPro" }, { "id": "IPR003595", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003595", "database": "InterPro" }, { "id": "IPR011993", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011993", "database": "InterPro" }, { "id": "IPR012151", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012151", "database": "InterPro" }, { "id": "IPR014352", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014352", "database": "InterPro" }, { "id": "IPR016130", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016130", "database": "InterPro" }, { "id": "IPR018979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018979", "database": "InterPro" }, { "id": "IPR018980", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018980", "database": "InterPro" }, { "id": "IPR019747", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019747", "database": "InterPro" }, { "id": "IPR019748", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019748", "database": "InterPro" }, { "id": "IPR019749", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019749", "database": "InterPro" }, { "id": "IPR029021", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029021", "database": "InterPro" }, { "id": "IPR029071", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029071", "database": "InterPro" }, { "id": "IPR035963", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035963", "database": "InterPro" }, { "id": "IPR036034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036034", "database": "InterPro" }, { "id": "IPR041783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041783", "database": "InterPro" }, { "id": "mmu:545622", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:545622", "database": "KEGG Pathway" }, { "id": "105307", "url": "http://www.informatics.jax.org/marker/MGI:105307", "database": "MGI" }, { "id": "EHHSFFQ", "url": "https://omabrowser.org/oma/group/EHHSFFQ/", "database": "OMA" }, { "id": "96595at2759", "url": "http://www.orthodb.org/?query=96595at2759", "database": "OrthoDB" }, { "id": "PF00102", "url": "http://pfam.xfam.org/family/PF00102", "database": "Pfam" }, { "id": "PF00373", "url": "http://pfam.xfam.org/family/PF00373", "database": "Pfam" }, { "id": "PF00595", "url": "http://pfam.xfam.org/family/PF00595", "database": "Pfam" }, { "id": "PF09379", "url": "http://pfam.xfam.org/family/PF09379", "database": "Pfam" }, { "id": "PF09380", "url": "http://pfam.xfam.org/family/PF09380", "database": "Pfam" }, { "id": "PR_A2ALK8", "url": "http://purl.obolibrary.org/obo/PR_A2ALK8", "database": "PRO" }, { "id": "R-MMU-182971", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-182971", "database": "Reactome" }, { "id": "R-MMU-5675221", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5675221", "database": "Reactome" }, { "id": "NP_035337", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035337", "database": "RefSeq" }, { "id": "10684", "url": "https://www.rhea-db.org/rhea/10684", "database": "Rhea" }, { "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8", "database": "UniProtKB" }, { "id": "A2ALK8-1", "url": "https://www.uniprot.org/uniprot/A2ALK8-1", "database": "UniProtKB" }, { "id": "A2ALK9", "url": "https://www.uniprot.org/uniprot/A2ALK9", "database": "UniProtKB" }, { "id": "A2ALK9-1", "url": "https://www.uniprot.org/uniprot/A2ALK9-1", "database": "UniProtKB" }, { "id": "A2ALL0", "url": "https://www.uniprot.org/uniprot/A2ALL0", "database": "UniProtKB" }, { "id": "A2ALL0-1", "url": "https://www.uniprot.org/uniprot/A2ALL0-1", "database": "UniProtKB" }, { "id": "A2ALL1", "url": "https://www.uniprot.org/uniprot/A2ALL1", "database": "UniProtKB" }, { "id": "A2ALL1-1", "url": "https://www.uniprot.org/uniprot/A2ALL1-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MTSRLRALGGRINNTRTSELPKEKTRSEVICSIRFLDGLVQTFKVNKQDLGQSLLDMAYGHLGVTEKEYFGLQHGDDPVDSPRWLEASKPLRKQLKGGFPCTLHFRVRYFIPDPNTLQQEQTRHLYFLQLKMDVCEGRLTCPLNSAVVLASYAVQSHFGDFNSSIHHPGYLADSQFIPDQNDDFLSKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHNLDLMIGIASAGIAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNPKKSVNNQYCKKVIGGMVWNPVMRRSLSVERLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGPLSPKDSDSEVSQNHSPHRESLSENNPAQSCLTQKSSSSVSPSSNAPGSCSPDGVDQRFLEDYHKVTKGGFVEDASQYYCDKSDDGDGYLVLIRITPDEEGRFGFNLKGGVDQKMPLVVSRINPESPADTCMPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRKAVRSLAEIRSEDELSQLFPEAMFPACPEGGDSLEGSMELLKKGLESGTVLIQFEQLYRKKPGLAVSFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEMPAANLVNKYIATQGPLPNTCAQFWQVVWDQKLSLVVMLTTLTERGRTKCHQYWPDPPDIMDHGIFHIQCQTEDCTIAYVSREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVKYVRSLRVDGEPALVHCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQRLDPS", "length": 913, "header": "sp|A2ALK8-1|PTN3_MOUSE Isoform 1 of Tyrosine-protein phosphatase non-receptor type 3 OS=Mus musculus OX=10090 GN=Ptpn3 PE=1 SV=1 CANONICAL=A2ALK8-1" }, "isoforms": [ { "isoform_ac": "A2ALK8-1", "url": "https://www.uniprot.org/uniprot/A2ALK8#A2ALK8-1", "sequence": { "sequence": "MTSRLRALGGRINNTRTSELPKEKTRSEVICSIRFLDGLVQTFKVNKQDLGQSLLDMAYGHLGVTEKEYFGLQHGDDPVDSPRWLEASKPLRKQLKGGFPCTLHFRVRYFIPDPNTLQQEQTRHLYFLQLKMDVCEGRLTCPLNSAVVLASYAVQSHFGDFNSSIHHPGYLADSQFIPDQNDDFLSKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHNLDLMIGIASAGIAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNPKKSVNNQYCKKVIGGMVWNPVMRRSLSVERLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGPLSPKDSDSEVSQNHSPHRESLSENNPAQSCLTQKSSSSVSPSSNAPGSCSPDGVDQRFLEDYHKVTKGGFVEDASQYYCDKSDDGDGYLVLIRITPDEEGRFGFNLKGGVDQKMPLVVSRINPESPADTCMPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRKAVRSLAEIRSEDELSQLFPEAMFPACPEGGDSLEGSMELLKKGLESGTVLIQFEQLYRKKPGLAVSFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEMPAANLVNKYIATQGPLPNTCAQFWQVVWDQKLSLVVMLTTLTERGRTKCHQYWPDPPDIMDHGIFHIQCQTEDCTIAYVSREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVKYVRSLRVDGEPALVHCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQRLDPS", "length": 913, "header": "sp|A2ALK8-1|PTN3_MOUSE Isoform 1 of Tyrosine-protein phosphatase non-receptor type 3 OS=Mus musculus OX=10090 GN=Ptpn3 PE=1 SV=1 CANONICAL=A2ALK8-1" }, "locus": { "chromosome": "4", "start_pos": 57270160, "end_pos": 57194288, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000075637", "url": "https://www.ensembl.org/id/ENSMUST00000075637" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000075063", "url": "https://www.ensembl.org/id/ENSMUSP00000075063" } ] } }, { "isoform_ac": "A2ALK9-1", "url": "https://www.uniprot.org/uniprot/A2ALK8#A2ALK9-1", "sequence": { "sequence": "MTSRLRALGGRINNTRTSELPKEKTRSEVICSIRFLDGLVQTFKVNKQDLGQSLLDMAYGHLGVTEKEYFGLQHGDDPVDSPRWLEASKPLRKQLKGGFPCTLHFRVRYFIPDPNTLQQEQTRHLYFLQLKMDVCEGRLTCPLNSAVVLASYAVQSHFGDFNSSIHHPGYLADSQFIPDQNDDFLSKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHN", "length": 229, "header": "tr|A2ALK9-1|PTN3_MOUSE Computationally mapped isoform of Tyrosine-protein phosphatase non-receptor type 3 OS=Mus musculus OX=10090 GN=Ptpn3 PE=1 SV=1 CANONICAL=A2ALK8-1" }, "locus": { "chromosome": "4", "start_pos": 57270160, "end_pos": 57245052, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000153926", "url": "https://www.ensembl.org/id/ENSMUST00000153926" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000122490", "url": "https://www.ensembl.org/id/ENSMUSP00000122490" } ] } }, { "isoform_ac": "A2ALL0-1", "url": "https://www.uniprot.org/uniprot/A2ALK8#A2ALL0-1", "sequence": { "sequence": "MTSRLRALGGRINNTRTSELPKEKTRSEVICSIRFLDGLVQTFKVNKQDLGQSLLDM", "length": 57, "header": "tr|A2ALL0-1|A2ALL0_MOUSE Computationally mapped isoform of Tyrosine-protein phosphatase non-receptor type 3 OS=Mus musculus OX=10090 GN=Ptpn3 PE=1 SV=1 CANONICAL=A2ALK8-1" }, "locus": { "chromosome": "4", "start_pos": 57270160, "end_pos": 57265058, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000130900", "url": "https://www.ensembl.org/id/ENSMUST00000130900" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000114805", "url": "https://www.ensembl.org/id/ENSMUSP00000114805" } ] } }, { "isoform_ac": "A2ALL1-1", "url": "https://www.uniprot.org/uniprot/A2ALK8#A2ALL1-1", "sequence": { "sequence": "MTSRLRALGGRINNTRTSELPKEKTRSEVICSIRFLD", "length": 37, "header": "tr|A2ALL1-1|A2ALL1_MOUSE Computationally mapped isoform of Tyrosine-protein phosphatase non-receptor type 3 OS=Mus musculus OX=10090 GN=Ptpn3 PE=4 SV=1 CANONICAL=A2ALK8-1" }, "locus": { "chromosome": "4", "start_pos": 57270160, "end_pos": 57270050, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000151964", "url": "https://www.ensembl.org/id/ENSMUST00000151964" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000120111", "url": "https://www.ensembl.org/id/ENSMUSP00000120111" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 357, "end_pos": 357, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ] }, { "start_pos": 359, "end_pos": 359, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ] }, { "start_pos": 367, "end_pos": 367, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ] }, { "start_pos": 376, "end_pos": 376, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ] }, { "start_pos": 381, "end_pos": 381, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ] }, { "start_pos": 425, "end_pos": 425, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ] } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Protein-tyrosine phosphatase H1 controls growth hormone receptor signaling and systemic growth.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Pilecka I, Patrignani C, Pescini R, Curchod ML, Perrin D, Xue Y, Yasenchak J, Clark A, Magnone MC, Zaratin P, Valenzuela D, Rommel C, Hooft van Huijsduijnen R", "evidence": [ { "database": "RefSeq", "id": "NP_035337", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035337" } ], "reference": [ { "type": "PubMed", "id": "17921143", "url": "https://glygen.org/publication/PubMed/17921143" } ] }, { "title": "The FERM and PDZ domain-containing protein tyrosine phosphatases, PTPN4 and PTPN3, are both dispensable for T cell receptor signal transduction.", "journal": "PloS one", "date": "2008", "authors": "Bauler TJ, Hendriks WJ, King PD", "evidence": [ { "database": "RefSeq", "id": "NP_035337", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035337" } ], "reference": [ { "type": "PubMed", "id": "19107198", "url": "https://glygen.org/publication/PubMed/19107198" } ] }, { "title": "p38gamma Mitogen-activated protein kinase signals through phosphorylating its phosphatase PTPH1 in regulating ras protein oncogenesis and stress response.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Hou S, Suresh PS, Qi X, Lepp A, Mirza SP, Chen G", "evidence": [ { "database": "RefSeq", "id": "NP_035337", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_035337" } ], "reference": [ { "type": "PubMed", "id": "22730326", "url": "https://glygen.org/publication/PubMed/22730326" } ] } ], "pathway": [ { "id": "mmu:545622", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:545622", "resource": "KEGG Pathway" }, { "id": "R-MMU-182971", "name": "EGFR downregulation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-182971", "resource": "Reactome", "description": "EGFR downregulation" }, { "id": "R-MMU-5675221", "name": "Negative regulation of MAPK pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5675221", "resource": "Reactome", "description": "Negative regulation of MAPK pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "F1LQQ5-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type", "gene_name": "Ptpn3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGRKVQSERRKAGVGGGGRGRLERRPLGALKALGRANLPGVLGPAKEPRDSQLSHGAAGVGATPNSATEPPSKARCHFRFVVRQALAIPRHAIPESQAHSYSAAVMTSRLRALGGRINNIRTSELPKEKTRSEVTCSIRFLDGLVQTFKVNKQDLGQSLLDMAYGHLGVTEKEYFGLQHGDDPVDSPRWLEASKPLRKQLKGGLPCILHFRVRYFIPDPNTLQQEQTRHLYFLQLKMDVCEGRLTCPLNSAVVLASYAVQSHIGDFNSSIHHPGYLADSQFIPDQNDDFLSKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHNLDLMIGIASAGIAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNPKKSVNNQYCKKVIGGMVWNPVMRRSLSVERLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSLSPKDSDSEVSQNHSPHRGSLSENNPAQSCLTQKSSSSVSPCSNAPGSFSPDGVDQQFLEDYHKVTKGGSIEEASQYYCDKNDDGDGYLVLIRITPDKEGRFGFNLKGGVDQKMPLVVSRINPESPADTCMPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRKAVRSLAEIRSEDELSQLFPEAMFPACPEGGDSLEGSMELLKKGLESGTVLIQFEQLYRKKPGLAVTFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLVVMLTTLTERGRTKCHQYWPDPPDIMDHGIFHIQCQAEDCTIAYVSREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVKYVRSLRVGGEPALVHCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQTLDPS", "length": 1018 }, "evidence": [ { "id": "74451", "url": "http://www.informatics.jax.org/homology/74451", "database": "MGI" }, { "id": "A2ALK8", "url": "https://omabrowser.org/oma/group/A2ALK8/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P26045-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 3", "gene_name": "PTPN3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDTGQVLLDMVHNHLGVTEKEYFGLQHDDDSVDSPRWLEASKAIRKQLKGGFPCTLHFRVRFFIPDPNTLQQEQTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSHFIPDQNEDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAGVAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVWNPAMRRSLSVEHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSLAPQDSDSEVSQNRSPHQESLSENNPAQSYLTQKSSSSVSPSSNAPGSCSPDGVDQQLLDDFHRVTKGGSTEDASQYYCDKNDNGDSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVRSFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCTIAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLVHCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQMLDPS", "length": 913 }, "evidence": [ { "id": "74451", "url": "http://www.informatics.jax.org/homology/74451", "database": "MGI" }, { "id": "A2ALK8", "url": "https://omabrowser.org/oma/group/A2ALK8/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "pmid": "" }, { "name": "cytoplasmic side of plasma membrane", "id": "GO:0009898", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009898", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "cytoskeletal protein binding", "id": "GO:0008092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008092", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "pmid": "" }, { "name": "phosphotyrosine residue binding", "id": "GO:0001784", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001784", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "pmid": "" }, { "name": "ATPase binding", "id": "GO:0051117", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051117", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "pmid": "" }, { "name": "sodium channel regulator activity", "id": "GO:0017080", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017080", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "pmid": "" }, { "name": "protein tyrosine phosphatase activity", "id": "GO:0004725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004725", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "negative regulation of membrane protein ectodomain proteolysis", "id": "GO:0051045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051045", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "pmid": "" }, { "name": "regulation of sodium ion transmembrane transporter activity", "id": "GO:2000649", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000649", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "pmid": "" }, { "name": "negative regulation of mitotic cell cycle", "id": "GO:0045930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045930", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "pmid": "" }, { "name": "protein dephosphorylation", "id": "GO:0006470", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006470", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "pmid": "" }, { "name": "liver regeneration", "id": "GO:0097421", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097421", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "pmid": "" }, { "name": "regulation of membrane depolarization during action potential", "id": "GO:0098902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098902", "evidence": [ { "database": "UniProtKB", "id": "A2ALK8", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 13, "end_pos": 15, "annotation": "n_glycosylation_sequon" }, { "start_pos": 162, "end_pos": 164, "annotation": "n_glycosylation_sequon" }, { "start_pos": 432, "end_pos": 434, "annotation": "n_glycosylation_sequon" }, { "start_pos": 697, "end_pos": 699, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "10684", "name": "", "equation": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q03348-1", "Q5M863-1", "A0A0G2K2W0-1", "P41498-1", "F1LX86-1", "Q64605-1", "E9PTJ3-1", "A0A0G2JZ01-1", "Q62656-1", "Q64612-1", "Q9JIM4-1", "D3ZBG7-1", "Q64604-1", "A5I9F0-1", "A0A0G2JXZ9-1", "P81718-1", "M0RB22-1", "O54838-1", "P48965-1", "A0A0G2K3I9-1", "A1L1L3-1", "B2GV87-1", "O88488-1", "O88902-1", "P04157-1", "P35233-1", "P35234-1", "P48966-1", "Q63475-1", "Q91XQ2-1", "B4F7B7-1", "Q5FVI9-1", "D3ZDK7-1", "P20417-1", "P49445-1", "Q5XIS1-1", "Q62728-1", "Q641Z2-1", "M0R587-1", "O08617-1", "Q6P9X4-1", "B2RZ50-1", "Q62767-1", "Q63340-1", "Q64346-1", "Q64623-1", "Q6AXW7-1", "A0A0G2K9N1-1", "P20646-1", "O54857-1", "Q2YDV1-1", "F1LQQ5-1", "D4A3W6-1", "G3V9S3-1", "P0C595-1", "F1LP13-1", "Q5PQT2-1", "D3ZVI5-1", "A0A0G2K754-1", "F1MAG7-1", "P41499-2", "P0C089-1", "A0A0G2K2N0-1", "F1LPJ1-1", "G3V6B9-1", "G3V7Q4-1", "Q62797-1", "F1LXJ9-1", "Q78EG7-1", "D4ADT2-1", "Q8WUK0-1", "Q05209-1", "Q9UMZ3-1", "P17706-1", "P30305-1", "Q9H3S7-1", "P08575-3", "P23471-1", "O95147-1", "P28562-1", "Q9BVJ7-1", "Q9H1R2-1", "Q05923-1", "P23470-1", "Q8TE77-1", "P56180-1", "Q9NYA4-1", "Q76I76-1", "O75365-1", "A6NDG6-1", "O75061-1", "Q06124-2", "P10586-1", "O95677-1", "Q99502-1", "Q15262-1", "Q99504-1", "P26045-1", "P30307-1", "Q12913-1", "Q9BY84-1", "Q16829-1", "P51452-1", "Q16690-1", "Q9NRW4-1", "Q16828-1", "Q99952-1", "P23467-1", "Q16827-1", "Q8TF42-1", "Q9H596-1", "Q13202-1", "Q8WTR2-1", "Q9UNI6-1", "Q4G0W2-1", "Q13115-1", "O60729-1", "Q9UNH5-1", "P35236-1", "A4D256-1", "Q9BV47-1", "Q99956-1", "P60484-1", "Q9HD43-1", "Q15678-1", "P23468-1", "P28827-1", "P43378-1", "Q13332-1", "Q16825-1", "Q12974-1", "Q8NEJ0-1", "P54829-1", "P29350-1", "P18031-1", "P18433-5", "O14522-3", "Q8WYL5-1", "Q16667-1", "P29074-1", "P30304-1", "P23469-1", "Q15256-1", "Q92729-1", "Q92932-1", "Q86V88-1", "Q9UII6-1", "Q13615-1", "P24666-1", "Q12923-1", "Q9Y6W6-1", "Q9Y2R2-1", "O00167-1", "Q4JDL3-1", "B3EWF7-1", "Q93096-1", "P15309-1", "Q63HR2-1", "Q68J44-1", "Q66GT5-1", "Q8K4T5-1", "Q8R4V2-1", "Q9D0T2-1", "Q9ESS0-1", "Q99N11-1", "Q9JLY7-1", "O09112-1", "Q05922-1", "Q8BTR5-1", "Q9D7X3-1", "Q9DBB1-1", "P97767-1", "Q9Z191-1", "O08575-1", "A2ALK8-1", "B0V2N1-1", "B2RU80-1", "E9Q612-1", "O35239-1", "O55082-1", "P28828-1", "P35831-1", "P49446-1", "P70289-1", "Q05909-1", "Q06180-1", "Q62130-1", "Q62132-1", "Q62136-1", "Q64455-1", "Q64487-4", "Q99M80-1", "P06800-4", "P0C5E4-1", "P35821-1", "Q61152-1", "Q64512-1", "Q76I79-1", "Q80TZ3-1", "Q6PFY9-1", "Q9D967-1", "P48967-1", "P30306-1", "Q91XS1-1", "Q8BK84-1", "Q9D358-1", "A2A8L5-1", "P48964-1", "Q9D9D8-1", "P28563-1", "P29352-1", "Q9QYJ7-1", "P18052-1", "P35235-2", "Q6PB44-1", "Q9D700-1", "Q8BFV3-1", "Q91Z46-1", "B9EKR1-1", "E9Q0N2-1", "P54830-1", "P80560-1", "Q8BUM3-1", "B1AUH1-1", "P35822-1", "Q8BGG7-1", "Q5SW75-1", "Q8VE01-1", "Q6GQT0-1", "Q810P3-1", "P29351-1", "Q9WU22-1", "Q8K330-1", "P97480-1", "O70274-1", "Q9D658-1", "O08586-1", "Q6NT99-1", "Q9WUA5-1", "Q8CHP8-1", "Q8CE08-1", "Q1HL35-1", "Q8K296-1", "Q63739-1", "Q7TNL7-1", "Q8CGB6-1", "O61722-1", "P29349-1", "P35992-5", "P82890-1", "P16621-1", "Q05201-1", "A1ZAB3-1", "P35832-1", "P82891-1", "Q6NN85-1", "Q86BN8-1", "Q9W0G1-1", "X2JEB8-1", "Q9VVW5-1", "Q9W4F5-1", "Q03019-1", "Q9VWF4-1", "P20483-1", "P16620-1", "Q9W0R3-1" ], "evidence": [ { "id": "10684", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/10684" } ] }, { "id": "R-MMU-8867047", "name": "PTPN3 dephosphorylates EPS15", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A2ALK8-1", "Q01279-1", "P22682-1" ], "evidence": [ { "id": "R-MMU-8867047", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8867047" } ] }, { "id": "R-MMU-8867654", "name": "PTPN3 binds p-T183,Y185 MAPK12", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A2ALK8-1", "O08911-1" ], "evidence": [ { "id": "R-MMU-8867654", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8867654" } ] }, { "id": "R-MMU-8867658", "name": "PTPN3 dephosphorylates MAPK12", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-MMU-171025", "R-MMU-8867650" ], "enzyme_list": [ "A2ALK8-1", "O08911-1" ], "evidence": [ { "id": "R-MMU-8867658", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8867658" } ] }, { "id": "R-MMU-8868118", "name": "MAPK12 phosphorylates PTPN3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A2ALK8-1", "O08911-1" ], "evidence": [ { "id": "R-MMU-8868118", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8868118" } ] } ], "reaction_participants": [ { "participant_id": "R-MMU-171025", "participant_name": "Mapk12 [cytosol]", "crossref": [ { "id": "ENSMUSG00000022610", "database": "Ensembl", "url": "" }, { "id": "NP_038899.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSP00000086207", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000088827", "database": "Ensembl", "url": "" }, { "id": "1353438", "database": "MGI", "url": "" }, { "id": "O08911", "database": "UniProt", "url": "" }, { "id": "O08911", "database": "PRO", "url": "" } ] }, { "participant_id": "R-MMU-8867650", "participant_name": "Ptpn3 [cytosol]", "crossref": [ { "id": "ENSMUST00000075637", "database": "Ensembl", "url": "" }, { "id": "NP_035337.2", "database": "RefSeq", "url": "" }, { "id": "105307", "database": "MGI", "url": "" }, { "id": "XP_006538163.1", "database": "RefSeq", "url": "" }, { "id": "XP_006538162.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSG00000038764", "database": "Ensembl", "url": "" }, { "id": "XP_006538161.1", "database": "RefSeq", "url": "" }, { "id": "A2ALK8", "database": "UniProt", "url": "" }, { "id": "A2ALK8", "database": "PRO", "url": "" }, { "id": "ENSMUSP00000075063", "database": "Ensembl", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JXZ9", "gene_name": "Ptprj", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "A0A0G2JXZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JXZ9" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A0A0G2JXZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JXZ9" } ] } ] }, { "uniprot_ac": "A0A0G2JZ01", "gene_name": "Eya3", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "A0A0G2JZ01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ01" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A0A0G2JZ01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JZ01" } ] } ] }, { "uniprot_ac": "A0A0G2K2N0", "gene_name": "Ptpn14", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "A0A0G2K2N0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K2N0" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A0A0G2K2N0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K2N0" } ] } ] }, { "uniprot_ac": "A0A0G2K2W0", "gene_name": "Ptprb", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "A0A0G2K2W0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K2W0" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A0A0G2K2W0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K2W0" } ] } ] }, { "uniprot_ac": "A0A0G2K3I9", "gene_name": "Dusp3", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "A0A0G2K3I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K3I9" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "A0A0G2K3I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K3I9" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A0A0G2K3I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K3I9" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "A0A0G2K3I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K3I9" } ] } ] }, { "uniprot_ac": "A0A0G2K754", "gene_name": "Ptprh", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "A0A0G2K754", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K754" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A0A0G2K754", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K754" } ] } ] }, { "uniprot_ac": "A0A0G2K9N1", "gene_name": "Dusp13", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "A0A0G2K9N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K9N1" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "A0A0G2K9N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K9N1" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "A0A0G2K9N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K9N1" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A0A0G2K9N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K9N1" } ] } ] }, { "uniprot_ac": "A1L1L3", "gene_name": "Ptpn20", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "A1L1L3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1L1L3" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A1L1L3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1L1L3" } ] } ] }, { "uniprot_ac": "A1ZAB3", "gene_name": "Ptp52F", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "A1ZAB3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZAB3" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A1ZAB3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A1ZAB3" } ] } ] }, { "uniprot_ac": "A2A8L5", "gene_name": "Ptprf", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "A2A8L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2A8L5" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A2A8L5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2A8L5" } ] } ] }, { "uniprot_ac": "A2ALK8", "gene_name": "Ptpn3", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "A2ALK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A2ALK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2ALK8" } ] } ] }, { "uniprot_ac": "A4D256", "gene_name": "CDC14C", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "A4D256", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A4D256" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "A4D256", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A4D256" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "A4D256", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A4D256" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A4D256", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A4D256" } ] } ] }, { "uniprot_ac": "A5I9F0", "gene_name": "Ptprk", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "A5I9F0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A5I9F0" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "A5I9F0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A5I9F0" } ] } ] }, { "uniprot_ac": "A6NDG6", "gene_name": "PGP", "activity": [ { "ec_number": "3.1.3.21", "activity": "sn-glycerol 1-phosphate + H(2)O = glycerol + phosphate.", "evidence": [ { "id": "A6NDG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NDG6" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "A6NDG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NDG6" } ] }, { "ec_number": "3.1.3.21", "activity": "", "evidence": [ { "id": "A6NDG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NDG6" } ] } ] }, { "uniprot_ac": "B0V2N1", "gene_name": "Ptprs", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "B0V2N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0V2N1" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "B0V2N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B0V2N1" } ] } ] }, { "uniprot_ac": "B1AUH1", "gene_name": "Ptpru", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "B1AUH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1AUH1" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "B1AUH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B1AUH1" } ] } ] }, { "uniprot_ac": "B2GV87", "gene_name": "Ptpre", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "B2GV87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GV87" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "B2GV87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2GV87" } ] } ] }, { "uniprot_ac": "B2RU80", "gene_name": "Ptprb", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "B2RU80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RU80" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "B2RU80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RU80" } ] } ] }, { "uniprot_ac": "B2RZ50", "gene_name": "Cdkn3", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "B2RZ50", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RZ50" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "B2RZ50", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RZ50" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "B2RZ50", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RZ50" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "B2RZ50", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RZ50" } ] } ] }, { "uniprot_ac": "B3EWF7", "gene_name": "EPM2A", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "B3EWF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B3EWF7" } ] }, { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "B3EWF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B3EWF7" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "B3EWF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B3EWF7" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "B3EWF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B3EWF7" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "B3EWF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B3EWF7" } ] } ] }, { "uniprot_ac": "B4F7B7", "gene_name": "Dusp15", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "B4F7B7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B4F7B7" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "B4F7B7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B4F7B7" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "B4F7B7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B4F7B7" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "B4F7B7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B4F7B7" } ] } ] }, { "uniprot_ac": "B9EKR1", "gene_name": "Ptprz1", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "B9EKR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B9EKR1" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "B9EKR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B9EKR1" } ] } ] }, { "uniprot_ac": "D3ZBG7", "gene_name": "Dusp10", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "D3ZBG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZBG7" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "D3ZBG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZBG7" } ] } ] }, { "uniprot_ac": "D3ZDK7", "gene_name": "Pgp", "activity": [ { "ec_number": "3.1.3.21", "activity": "sn-glycerol 1-phosphate + H(2)O = glycerol + phosphate.", "evidence": [ { "id": "D3ZDK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDK7" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "D3ZDK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDK7" } ] }, { "ec_number": "3.1.3.21", "activity": "", "evidence": [ { "id": "D3ZDK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZDK7" } ] } ] }, { "uniprot_ac": "D3ZVI5", "gene_name": "Eya1", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "D3ZVI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZVI5" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "D3ZVI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZVI5" } ] } ] }, { "uniprot_ac": "D4A3W6", "gene_name": "Dusp16", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "D4A3W6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A3W6" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "D4A3W6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A3W6" } ] } ] }, { "uniprot_ac": "D4ADT2", "gene_name": "Cdc25c", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "D4ADT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADT2" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "D4ADT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4ADT2" } ] } ] }, { "uniprot_ac": "E9PTJ3", "gene_name": "Eya2", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "E9PTJ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PTJ3" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "E9PTJ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PTJ3" } ] } ] }, { "uniprot_ac": "E9Q0N2", "gene_name": "Ptprh", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "E9Q0N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q0N2" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "E9Q0N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q0N2" } ] } ] }, { "uniprot_ac": "E9Q612", "gene_name": "Ptpro", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "E9Q612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q612" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "E9Q612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q612" } ] } ] }, { "uniprot_ac": "F1LP13", "gene_name": "Ptprg", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "F1LP13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LP13" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "F1LP13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LP13" } ] } ] }, { "uniprot_ac": "F1LPJ1", "gene_name": "Ptprm", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "F1LPJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LPJ1" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "F1LPJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LPJ1" } ] } ] }, { "uniprot_ac": "F1LQQ5", "gene_name": "Ptpn3", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "F1LQQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LQQ5" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "F1LQQ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LQQ5" } ] } ] }, { "uniprot_ac": "F1LX86", "gene_name": "Eya4", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "F1LX86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LX86" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "F1LX86", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LX86" } ] } ] }, { "uniprot_ac": "F1LXJ9", "gene_name": "Ptprt", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "F1LXJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LXJ9" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "F1LXJ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LXJ9" } ] } ] }, { "uniprot_ac": "F1MAG7", "gene_name": "Ptpru", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "F1MAG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1MAG7" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "F1MAG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1MAG7" } ] } ] }, { "uniprot_ac": "G3V6B9", "gene_name": "Ptpn4", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "G3V6B9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V6B9" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "G3V6B9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V6B9" } ] } ] }, { "uniprot_ac": "G3V7Q4", "gene_name": "Ptpn12", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "G3V7Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V7Q4" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "G3V7Q4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V7Q4" } ] } ] }, { "uniprot_ac": "G3V9S3", "gene_name": "Ptpn13", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "G3V9S3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V9S3" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "G3V9S3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G3V9S3" } ] } ] }, { "uniprot_ac": "M0R587", "gene_name": "LOC108348179", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "M0R587", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0R587" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "M0R587", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0R587" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "M0R587", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0R587" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "M0R587", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0R587" } ] } ] }, { "uniprot_ac": "M0RB22", "gene_name": "Ptprd", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "M0RB22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RB22" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "M0RB22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/M0RB22" } ] } ] }, { "uniprot_ac": "O00167", "gene_name": "EYA2", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O00167", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00167" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O00167", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00167" } ] } ] }, { "uniprot_ac": "O08575", "gene_name": "Eya2", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O08575", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08575" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O08575", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08575" } ] } ] }, { "uniprot_ac": "O08586", "gene_name": "Pten", "activity": [ { "ec_number": "3.1.3.67", "activity": "Phosphatidylinositol 3,4,5-trisphosphate + H(2)O = phosphatidylinositol 4,5-bisphosphate + phosphate.", "evidence": [ { "id": "O08586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08586" } ] }, { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "O08586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08586" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O08586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08586" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "O08586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08586" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O08586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08586" } ] }, { "ec_number": "3.1.3.67", "activity": "", "evidence": [ { "id": "O08586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08586" } ] } ] }, { "uniprot_ac": "O08617", "gene_name": "Ptprr", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O08617", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08617" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O08617", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08617" } ] } ] }, { "uniprot_ac": "O08911", "gene_name": "Mapk12", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + a protein = ADP + a phosphoprotein.", "evidence": [ { "id": "O08911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08911" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "O08911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08911" } ] } ] }, { "uniprot_ac": "O09112", "gene_name": "Dusp8", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "O09112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09112" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O09112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09112" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O09112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09112" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "O09112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O09112" } ] } ] }, { "uniprot_ac": "O14522", "gene_name": "PTPRT", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O14522", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14522" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O14522", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14522" } ] } ] }, { "uniprot_ac": "O35239", "gene_name": "Ptpn9", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O35239", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35239" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O35239", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35239" } ] } ] }, { "uniprot_ac": "O54838", "gene_name": "Dusp5", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "O54838", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54838" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O54838", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54838" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "O54838", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54838" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O54838", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54838" } ] } ] }, { "uniprot_ac": "O54857", "gene_name": "Pten", "activity": [ { "ec_number": "3.1.3.67", "activity": "Phosphatidylinositol 3,4,5-trisphosphate + H(2)O = phosphatidylinositol 4,5-bisphosphate + phosphate.", "evidence": [ { "id": "O54857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54857" } ] }, { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "O54857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54857" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O54857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54857" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "O54857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54857" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O54857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54857" } ] }, { "ec_number": "3.1.3.67", "activity": "", "evidence": [ { "id": "O54857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54857" } ] } ] }, { "uniprot_ac": "O55082", "gene_name": "Ptpn20", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O55082", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55082" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O55082", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55082" } ] } ] }, { "uniprot_ac": "O60729", "gene_name": "CDC14B", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "O60729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60729" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O60729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60729" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O60729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60729" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "O60729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60729" } ] } ] }, { "uniprot_ac": "O61722", "gene_name": "PRL-1", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O61722", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O61722" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O61722", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O61722" } ] } ] }, { "uniprot_ac": "O70274", "gene_name": "Ptp4a2", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O70274", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70274" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O70274", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70274" } ] } ] }, { "uniprot_ac": "O75061", "gene_name": "DNAJC6", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O75061", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75061" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O75061", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75061" } ] } ] }, { "uniprot_ac": "O75365", "gene_name": "PTP4A3", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O75365", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75365" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O75365", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75365" } ] } ] }, { "uniprot_ac": "O88488", "gene_name": "Ptprq", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "O88488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88488" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O88488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88488" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O88488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88488" } ] } ] }, { "uniprot_ac": "O88902", "gene_name": "Ptpn23", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O88902", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88902" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O88902", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88902" } ] } ] }, { "uniprot_ac": "O95147", "gene_name": "DUSP14", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "O95147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95147" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O95147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95147" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "O95147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95147" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O95147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95147" } ] } ] }, { "uniprot_ac": "O95677", "gene_name": "EYA4", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "O95677", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95677" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "O95677", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95677" } ] } ] }, { "uniprot_ac": "P04157", "gene_name": "Ptprc", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P04157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04157" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P04157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04157" } ] } ] }, { "uniprot_ac": "P06800", "gene_name": "Ptprc", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P06800", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06800" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P06800", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06800" } ] } ] }, { "uniprot_ac": "P08575", "gene_name": "PTPRC", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P08575", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08575" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P08575", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08575" } ] } ] }, { "uniprot_ac": "P0C089", "gene_name": "Ptpmt1", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "P0C089", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C089" } ] }, { "ec_number": "3.1.3.27", "activity": "Phosphatidylglycerophosphate + H(2)O = phosphatidylglycerol + phosphate.", "evidence": [ { "id": "P0C089", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C089" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P0C089", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C089" } ] }, { "ec_number": "3.1.3.27", "activity": "", "evidence": [ { "id": "P0C089", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C089" } ] } ] }, { "uniprot_ac": "P0C595", "gene_name": "Dusp29", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "P0C595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C595" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P0C595", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C595" } ] } ] }, { "uniprot_ac": "P0C5E4", "gene_name": "Ptprq", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "P0C5E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C5E4" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P0C5E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C5E4" } ] } ] }, { "uniprot_ac": "P10586", "gene_name": "PTPRF", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P10586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10586" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P10586", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10586" } ] } ] }, { "uniprot_ac": "P15309", "gene_name": "ACP3", "activity": [ { "ec_number": "3.1.3.5", "activity": "A 5'-ribonucleotide + H(2)O = a ribonucleoside + phosphate.", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] }, { "ec_number": "3.1.3.2", "activity": "A phosphate monoester + H(2)O = an alcohol + phosphate.", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P15309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15309" } ] } ] }, { "uniprot_ac": "P16620", "gene_name": "Ptp69D", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P16620", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16620" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P16620", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16620" } ] } ] }, { "uniprot_ac": "P16621", "gene_name": "Lar", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P16621", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16621" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P16621", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16621" } ] } ] }, { "uniprot_ac": "P17706", "gene_name": "PTPN2", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P17706", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17706" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P17706", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17706" } ] } ] }, { "uniprot_ac": "P18031", "gene_name": "PTPN1", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P18031", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18031" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P18031", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18031" } ] } ] }, { "uniprot_ac": "P18052", "gene_name": "Ptpra", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P18052", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18052" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P18052", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18052" } ] } ] }, { "uniprot_ac": "P18433", "gene_name": "PTPRA", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P18433", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18433" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P18433", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18433" } ] } ] }, { "uniprot_ac": "P20417", "gene_name": "Ptpn1", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P20417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20417" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P20417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20417" } ] } ] }, { "uniprot_ac": "P20483", "gene_name": "stg", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P20483", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20483" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P20483", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20483" } ] } ] }, { "uniprot_ac": "P20646", "gene_name": "Acp3", "activity": [ { "ec_number": "3.1.3.5", "activity": "A 5'-ribonucleotide + H(2)O = a ribonucleoside + phosphate.", "evidence": [ { "id": "P20646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20646" } ] }, { "ec_number": "3.1.3.2", "activity": "A phosphate monoester + H(2)O = an alcohol + phosphate.", "evidence": [ { "id": "P20646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20646" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P20646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20646" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P20646", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20646" } ] } ] }, { "uniprot_ac": "P22682", "gene_name": "Cbl", "activity": [ { "ec_number": "2.3.2.7", "activity": "L-asparagine + hydroxylamine = NH(3) + beta-L-aspartylhydroxamate.", "evidence": [ { "id": "P22682", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22682" } ] }, { "ec_number": "2.3.2.7", "activity": "", "evidence": [ { "id": "P22682", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22682" } ] }, { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P22682", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22682" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P22682", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22682" } ] } ] }, { "uniprot_ac": "P23467", "gene_name": "PTPRB", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P23467", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23467" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P23467", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23467" } ] } ] }, { "uniprot_ac": "P23468", "gene_name": "PTPRD", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P23468", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23468" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P23468", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23468" } ] } ] }, { "uniprot_ac": "P23469", "gene_name": "PTPRE", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P23469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23469" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P23469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23469" } ] } ] }, { "uniprot_ac": "P23470", "gene_name": "PTPRG", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P23470", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23470" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P23470", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23470" } ] } ] }, { "uniprot_ac": "P23471", "gene_name": "PTPRZ1", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P23471", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23471" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P23471", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23471" } ] } ] }, { "uniprot_ac": "P24666", "gene_name": "ACP1", "activity": [ { "ec_number": "3.1.3.2", "activity": "A phosphate monoester + H(2)O = an alcohol + phosphate.", "evidence": [ { "id": "P24666", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24666" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P24666", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24666" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P24666", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24666" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P24666", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24666" } ] } ] }, { "uniprot_ac": "P26045", "gene_name": "PTPN3", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P26045", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26045" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P26045", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26045" } ] } ] }, { "uniprot_ac": "P28562", "gene_name": "DUSP1", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "P28562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28562" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P28562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28562" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "P28562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28562" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P28562", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28562" } ] } ] }, { "uniprot_ac": "P28563", "gene_name": "Dusp1", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P28563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28563" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P28563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28563" } ] }, { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "P28563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28563" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "P28563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28563" } ] } ] }, { "uniprot_ac": "P28827", "gene_name": "PTPRM", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P28827", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28827" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P28827", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28827" } ] } ] }, { "uniprot_ac": "P28828", "gene_name": "Ptprm", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P28828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28828" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P28828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28828" } ] } ] }, { "uniprot_ac": "P29074", "gene_name": "PTPN4", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P29074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29074" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P29074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29074" } ] } ] }, { "uniprot_ac": "P29349", "gene_name": "csw", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P29349", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29349" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P29349", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29349" } ] } ] }, { "uniprot_ac": "P29350", "gene_name": "PTPN6", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P29350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29350" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P29350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29350" } ] } ] }, { "uniprot_ac": "P29351", "gene_name": "Ptpn6", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P29351", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29351" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P29351", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29351" } ] } ] }, { "uniprot_ac": "P29352", "gene_name": "Ptpn22", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P29352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29352" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P29352", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29352" } ] } ] }, { "uniprot_ac": "P30304", "gene_name": "CDC25A", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P30304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30304" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P30304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30304" } ] } ] }, { "uniprot_ac": "P30305", "gene_name": "CDC25B", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P30305", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30305" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P30305", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30305" } ] } ] }, { "uniprot_ac": "P30306", "gene_name": "Cdc25b", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P30306", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30306" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P30306", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30306" } ] } ] }, { "uniprot_ac": "P30307", "gene_name": "CDC25C", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P30307", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30307" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P30307", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30307" } ] } ] }, { "uniprot_ac": "P35233", "gene_name": "Ptpn2", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P35233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35233" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P35233", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35233" } ] } ] }, { "uniprot_ac": "P35234", "gene_name": "Ptpn5", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P35234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35234" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P35234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35234" } ] } ] }, { "uniprot_ac": "P35235", "gene_name": "Ptpn11", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P35235", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35235" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P35235", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35235" } ] } ] }, { "uniprot_ac": "P35236", "gene_name": "PTPN7", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P35236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35236" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P35236", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35236" } ] } ] }, { "uniprot_ac": "P35821", "gene_name": "Ptpn1", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P35821", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35821" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P35821", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35821" } ] } ] }, { "uniprot_ac": "P35822", "gene_name": "Ptprk", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P35822", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35822" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P35822", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35822" } ] } ] }, { "uniprot_ac": "P35831", "gene_name": "Ptpn12", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P35831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35831" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P35831", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35831" } ] } ] }, { "uniprot_ac": "P35832", "gene_name": "Ptp99A", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P35832", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35832" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P35832", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35832" } ] } ] }, { "uniprot_ac": "P35992", "gene_name": "Ptp10D", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P35992", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35992" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P35992", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35992" } ] } ] }, { "uniprot_ac": "P41498", "gene_name": "Acp1", "activity": [ { "ec_number": "3.1.3.2", "activity": "A phosphate monoester + H(2)O = an alcohol + phosphate.", "evidence": [ { "id": "P41498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41498" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P41498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41498" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P41498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41498" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "P41498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41498" } ] } ] }, { "uniprot_ac": "P41499", "gene_name": "Ptpn11", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P41499", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41499" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P41499", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41499" } ] } ] }, { "uniprot_ac": "P43378", "gene_name": "PTPN9", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P43378", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43378" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P43378", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43378" } ] } ] }, { "uniprot_ac": "P48964", "gene_name": "Cdc25a", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P48964", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48964" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P48964", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48964" } ] } ] }, { "uniprot_ac": "P48965", "gene_name": "Cdc25a", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P48965", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48965" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P48965", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48965" } ] } ] }, { "uniprot_ac": "P48966", "gene_name": "Cdc25b", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P48966", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48966" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P48966", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48966" } ] } ] }, { "uniprot_ac": "P48967", "gene_name": "Cdc25c", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P48967", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48967" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P48967", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48967" } ] } ] }, { "uniprot_ac": "P49445", "gene_name": "Ptpn7", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P49445", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49445" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P49445", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49445" } ] } ] }, { "uniprot_ac": "P49446", "gene_name": "Ptpre", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P49446", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49446" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P49446", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49446" } ] } ] }, { "uniprot_ac": "P51452", "gene_name": "DUSP3", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "P51452", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51452" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "P51452", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51452" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P51452", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51452" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P51452", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51452" } ] } ] }, { "uniprot_ac": "P54829", "gene_name": "PTPN5", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P54829", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54829" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P54829", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54829" } ] } ] }, { "uniprot_ac": "P54830", "gene_name": "Ptpn5", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P54830", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54830" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P54830", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54830" } ] } ] }, { "uniprot_ac": "P56180", "gene_name": "TPTE", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P56180", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56180" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P56180", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56180" } ] } ] }, { "uniprot_ac": "P60484", "gene_name": "PTEN", "activity": [ { "ec_number": "3.1.3.67", "activity": "Phosphatidylinositol 3,4,5-trisphosphate + H(2)O = phosphatidylinositol 4,5-bisphosphate + phosphate.", "evidence": [ { "id": "P60484", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60484" } ] }, { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "P60484", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60484" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P60484", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60484" } ] }, { "ec_number": "3.1.3.67", "activity": "", "evidence": [ { "id": "P60484", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60484" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P60484", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60484" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "P60484", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60484" } ] } ] }, { "uniprot_ac": "P70289", "gene_name": "Ptprv", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P70289", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70289" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P70289", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70289" } ] } ] }, { "uniprot_ac": "P80560", "gene_name": "Ptprn2", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "P80560", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80560" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P80560", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80560" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P80560", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80560" } ] } ] }, { "uniprot_ac": "P81718", "gene_name": "Ptpn6", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P81718", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P81718" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P81718", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P81718" } ] } ] }, { "uniprot_ac": "P82890", "gene_name": "primo-1", "activity": [ { "ec_number": "3.1.3.2", "activity": "A phosphate monoester + H(2)O = an alcohol + phosphate.", "evidence": [ { "id": "P82890", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82890" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P82890", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82890" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P82890", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82890" } ] } ] }, { "uniprot_ac": "P82891", "gene_name": "primo-2", "activity": [ { "ec_number": "3.1.3.2", "activity": "A phosphate monoester + H(2)O = an alcohol + phosphate.", "evidence": [ { "id": "P82891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82891" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P82891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82891" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P82891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P82891" } ] } ] }, { "uniprot_ac": "P97480", "gene_name": "Eya3", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P97480", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97480" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P97480", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97480" } ] } ] }, { "uniprot_ac": "P97767", "gene_name": "Eya1", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "P97767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97767" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P97767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97767" } ] }, { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "P97767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97767" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "P97767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97767" } ] } ] }, { "uniprot_ac": "Q01279", "gene_name": "Egfr", "activity": [ { "ec_number": "2.7.10.1", "activity": "ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.", "evidence": [ { "id": "Q01279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01279" } ] }, { "ec_number": "2.7.10.1", "activity": "", "evidence": [ { "id": "Q01279", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01279" } ] } ] }, { "uniprot_ac": "Q03019", "gene_name": "twe", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q03019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03019" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q03019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03019" } ] } ] }, { "uniprot_ac": "Q03348", "gene_name": "Ptpra", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q03348", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03348" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q03348", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03348" } ] } ] }, { "uniprot_ac": "Q05201", "gene_name": "eya", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q05201", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05201" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q05201", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05201" } ] } ] }, { "uniprot_ac": "Q05209", "gene_name": "PTPN12", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q05209", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05209" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q05209", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05209" } ] } ] }, { "uniprot_ac": "Q05909", "gene_name": "Ptprg", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q05909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05909" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q05909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05909" } ] } ] }, { "uniprot_ac": "Q05922", "gene_name": "Dusp2", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q05922", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05922" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q05922", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05922" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q05922", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05922" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q05922", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05922" } ] } ] }, { "uniprot_ac": "Q05923", "gene_name": "DUSP2", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q05923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05923" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q05923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05923" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q05923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05923" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q05923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05923" } ] } ] }, { "uniprot_ac": "Q06124", "gene_name": "PTPN11", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q06124", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06124" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q06124", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06124" } ] } ] }, { "uniprot_ac": "Q06180", "gene_name": "Ptpn2", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q06180", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06180" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q06180", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06180" } ] } ] }, { "uniprot_ac": "Q12913", "gene_name": "PTPRJ", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q12913", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12913" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q12913", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12913" } ] } ] }, { "uniprot_ac": "Q12923", "gene_name": "PTPN13", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q12923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12923" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q12923", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12923" } ] } ] }, { "uniprot_ac": "Q12974", "gene_name": "PTP4A2", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q12974", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12974" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q12974", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12974" } ] } ] }, { "uniprot_ac": "Q13115", "gene_name": "DUSP4", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q13115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13115" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q13115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13115" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q13115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13115" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q13115", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13115" } ] } ] }, { "uniprot_ac": "Q13202", "gene_name": "DUSP8", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q13202", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13202" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q13202", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13202" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q13202", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13202" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q13202", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13202" } ] } ] }, { "uniprot_ac": "Q13332", "gene_name": "PTPRS", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q13332", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13332" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q13332", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13332" } ] } ] }, { "uniprot_ac": "Q13615", "gene_name": "MTMR3", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q13615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13615" } ] }, { "ec_number": "3.1.3.64", "activity": "1-phosphatidyl-1D-myo-inositol 3-phosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol + phosphate.", "evidence": [ { "id": "Q13615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13615" } ] }, { "ec_number": "3.1.3.64", "activity": "", "evidence": [ { "id": "Q13615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13615" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q13615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13615" } ] }, { "ec_number": "3.1.3.95", "activity": "1-phosphatidyl-1D-myo-inositol 3,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate + phosphate.", "evidence": [ { "id": "Q13615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13615" } ] } ] }, { "uniprot_ac": "Q15256", "gene_name": "PTPRR", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q15256", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15256" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q15256", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15256" } ] } ] }, { "uniprot_ac": "Q15262", "gene_name": "PTPRK", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q15262", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15262" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q15262", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15262" } ] } ] }, { "uniprot_ac": "Q15678", "gene_name": "PTPN14", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q15678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15678" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q15678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15678" } ] } ] }, { "uniprot_ac": "Q16667", "gene_name": "CDKN3", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q16667", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16667" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q16667", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16667" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q16667", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16667" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q16667", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16667" } ] } ] }, { "uniprot_ac": "Q16690", "gene_name": "DUSP5", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q16690", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16690" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q16690", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16690" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q16690", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16690" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q16690", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16690" } ] } ] }, { "uniprot_ac": "Q16825", "gene_name": "PTPN21", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q16825", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16825" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q16825", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16825" } ] } ] }, { "uniprot_ac": "Q16827", "gene_name": "PTPRO", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q16827", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16827" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q16827", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16827" } ] } ] }, { "uniprot_ac": "Q16828", "gene_name": "DUSP6", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q16828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16828" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q16828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16828" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q16828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16828" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q16828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16828" } ] } ] }, { "uniprot_ac": "Q16829", "gene_name": "DUSP7", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q16829", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16829" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q16829", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16829" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q16829", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16829" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q16829", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16829" } ] } ] }, { "uniprot_ac": "Q1HL35", "gene_name": "Dusp5", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q1HL35", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1HL35" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q1HL35", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1HL35" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q1HL35", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1HL35" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q1HL35", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1HL35" } ] } ] }, { "uniprot_ac": "Q2YDV1", "gene_name": "Dusp9", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q2YDV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2YDV1" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q2YDV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2YDV1" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q2YDV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2YDV1" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q2YDV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q2YDV1" } ] } ] }, { "uniprot_ac": "Q4G0W2", "gene_name": "DUSP28", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q4G0W2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4G0W2" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q4G0W2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4G0W2" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q4G0W2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4G0W2" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q4G0W2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4G0W2" } ] } ] }, { "uniprot_ac": "Q4JDL3", "gene_name": "PTPN20", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q4JDL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4JDL3" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q4JDL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4JDL3" } ] } ] }, { "uniprot_ac": "Q5FVI9", "gene_name": "Dusp26", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q5FVI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FVI9" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q5FVI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FVI9" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q5FVI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FVI9" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q5FVI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FVI9" } ] } ] }, { "uniprot_ac": "Q5M863", "gene_name": "Dusp2", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q5M863", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5M863" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q5M863", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5M863" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q5M863", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5M863" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q5M863", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5M863" } ] } ] }, { "uniprot_ac": "Q5PQT2", "gene_name": "Mtmr3", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q5PQT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5PQT2" } ] }, { "ec_number": "3.1.3.64", "activity": "1-phosphatidyl-1D-myo-inositol 3-phosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol + phosphate.", "evidence": [ { "id": "Q5PQT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5PQT2" } ] }, { "ec_number": "3.1.3.95", "activity": "1-phosphatidyl-1D-myo-inositol 3,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate + phosphate.", "evidence": [ { "id": "Q5PQT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5PQT2" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q5PQT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5PQT2" } ] }, { "ec_number": "3.1.3.64", "activity": "", "evidence": [ { "id": "Q5PQT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5PQT2" } ] } ] }, { "uniprot_ac": "Q5SW75", "gene_name": "Ssh2", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q5SW75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SW75" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q5SW75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SW75" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q5SW75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SW75" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q5SW75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5SW75" } ] } ] }, { "uniprot_ac": "Q5XIS1", "gene_name": "Ssh3", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q5XIS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIS1" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q5XIS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIS1" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q5XIS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIS1" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q5XIS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIS1" } ] } ] }, { "uniprot_ac": "Q61152", "gene_name": "Ptpn18", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q61152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61152" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q61152", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61152" } ] } ] }, { "uniprot_ac": "Q62130", "gene_name": "Ptpn14", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q62130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62130" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q62130", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62130" } ] } ] }, { "uniprot_ac": "Q62132", "gene_name": "Ptprr", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q62132", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62132" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q62132", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62132" } ] } ] }, { "uniprot_ac": "Q62136", "gene_name": "Ptpn21", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q62136", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62136" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q62136", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62136" } ] } ] }, { "uniprot_ac": "Q62656", "gene_name": "Ptprz1", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q62656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62656" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q62656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62656" } ] } ] }, { "uniprot_ac": "Q62728", "gene_name": "Ptpn21", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q62728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62728" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q62728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62728" } ] } ] }, { "uniprot_ac": "Q62767", "gene_name": "Dusp4", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q62767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62767" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q62767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62767" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q62767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62767" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q62767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62767" } ] } ] }, { "uniprot_ac": "Q62797", "gene_name": "Ptpro", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q62797", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62797" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q62797", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62797" } ] } ] }, { "uniprot_ac": "Q63340", "gene_name": "Dusp7", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q63340", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63340" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q63340", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63340" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q63340", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63340" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q63340", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63340" } ] } ] }, { "uniprot_ac": "Q63475", "gene_name": "Ptprn2", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q63475", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63475" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q63475", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63475" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q63475", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63475" } ] } ] }, { "uniprot_ac": "Q63739", "gene_name": "Ptp4a1", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q63739", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63739" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q63739", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63739" } ] } ] }, { "uniprot_ac": "Q63HR2", "gene_name": "TNS2", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q63HR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63HR2" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q63HR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63HR2" } ] } ] }, { "uniprot_ac": "Q641Z2", "gene_name": "Ptpn9", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q641Z2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q641Z2" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q641Z2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q641Z2" } ] } ] }, { "uniprot_ac": "Q64346", "gene_name": "Dusp6", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q64346", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64346" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q64346", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64346" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q64346", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64346" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q64346", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64346" } ] } ] }, { "uniprot_ac": "Q64455", "gene_name": "Ptprj", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q64455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64455" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q64455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64455" } ] } ] }, { "uniprot_ac": "Q64487", "gene_name": "Ptprd", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q64487", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64487" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q64487", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64487" } ] } ] }, { "uniprot_ac": "Q64512", "gene_name": "Ptpn13", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q64512", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64512" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q64512", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64512" } ] } ] }, { "uniprot_ac": "Q64604", "gene_name": "Ptprf", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q64604", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64604" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q64604", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64604" } ] } ] }, { "uniprot_ac": "Q64605", "gene_name": "Ptprs", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q64605", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64605" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q64605", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64605" } ] } ] }, { "uniprot_ac": "Q64612", "gene_name": "Ptprv", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q64612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64612" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q64612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64612" } ] } ] }, { "uniprot_ac": "Q64623", "gene_name": "Dusp1", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q64623", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64623" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q64623", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64623" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q64623", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64623" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q64623", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64623" } ] } ] }, { "uniprot_ac": "Q66GT5", "gene_name": "Ptpmt1", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q66GT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66GT5" } ] }, { "ec_number": "3.1.3.27", "activity": "Phosphatidylglycerophosphate + H(2)O = phosphatidylglycerol + phosphate.", "evidence": [ { "id": "Q66GT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66GT5" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q66GT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66GT5" } ] }, { "ec_number": "3.1.3.27", "activity": "", "evidence": [ { "id": "Q66GT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66GT5" } ] } ] }, { "uniprot_ac": "Q68J44", "gene_name": "DUSP29", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q68J44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68J44" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q68J44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68J44" } ] } ] }, { "uniprot_ac": "Q6AXW7", "gene_name": "Dusp18", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q6AXW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXW7" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q6AXW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXW7" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q6AXW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXW7" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q6AXW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXW7" } ] } ] }, { "uniprot_ac": "Q6GQT0", "gene_name": "Cdc14a", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q6GQT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6GQT0" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q6GQT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6GQT0" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q6GQT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6GQT0" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q6GQT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6GQT0" } ] } ] }, { "uniprot_ac": "Q6NN85", "gene_name": "ssh", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q6NN85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NN85" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q6NN85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NN85" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q6NN85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NN85" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q6NN85", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NN85" } ] } ] }, { "uniprot_ac": "Q6NT99", "gene_name": "Dusp23", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q6NT99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NT99" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q6NT99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NT99" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q6NT99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NT99" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q6NT99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NT99" } ] } ] }, { "uniprot_ac": "Q6P9X4", "gene_name": "Ptp4a2", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q6P9X4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P9X4" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q6P9X4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P9X4" } ] } ] }, { "uniprot_ac": "Q6PB44", "gene_name": "Ptpn23", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q6PB44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PB44" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q6PB44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PB44" } ] } ] }, { "uniprot_ac": "Q6PFY9", "gene_name": "Cdc14b", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q6PFY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PFY9" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q6PFY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PFY9" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q6PFY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PFY9" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q6PFY9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PFY9" } ] } ] }, { "uniprot_ac": "Q76I76", "gene_name": "SSH2", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q76I76", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76I76" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q76I76", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76I76" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q76I76", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76I76" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q76I76", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76I76" } ] } ] }, { "uniprot_ac": "Q76I79", "gene_name": "Ssh1", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q76I79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76I79" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q76I79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76I79" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q76I79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76I79" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q76I79", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q76I79" } ] } ] }, { "uniprot_ac": "Q78EG7", "gene_name": "Ptp4a1", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q78EG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q78EG7" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q78EG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q78EG7" } ] } ] }, { "uniprot_ac": "Q7TNL7", "gene_name": "Dusp9", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q7TNL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TNL7" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q7TNL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TNL7" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q7TNL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TNL7" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q7TNL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TNL7" } ] } ] }, { "uniprot_ac": "Q80TZ3", "gene_name": "Dnajc6", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q80TZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80TZ3" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q80TZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80TZ3" } ] } ] }, { "uniprot_ac": "Q810P3", "gene_name": "Cdkn3", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q810P3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810P3" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q810P3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810P3" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q810P3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810P3" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q810P3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810P3" } ] } ] }, { "uniprot_ac": "Q86BN8", "gene_name": "PTPMT1", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q86BN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86BN8" } ] }, { "ec_number": "3.1.3.27", "activity": "Phosphatidylglycerophosphate + H(2)O = phosphatidylglycerol + phosphate.", "evidence": [ { "id": "Q86BN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86BN8" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q86BN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86BN8" } ] }, { "ec_number": "3.1.3.27", "activity": "", "evidence": [ { "id": "Q86BN8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86BN8" } ] } ] }, { "uniprot_ac": "Q86V88", "gene_name": "MDP1", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q86V88", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86V88" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q86V88", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86V88" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q86V88", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86V88" } ] } ] }, { "uniprot_ac": "Q8BFV3", "gene_name": "Dusp4", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q8BFV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BFV3" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8BFV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BFV3" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q8BFV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BFV3" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8BFV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BFV3" } ] } ] }, { "uniprot_ac": "Q8BGG7", "gene_name": "Ubash3b", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8BGG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGG7" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8BGG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGG7" } ] } ] }, { "uniprot_ac": "Q8BK84", "gene_name": "Dusp29", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q8BK84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BK84" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8BK84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BK84" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8BK84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BK84" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q8BK84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BK84" } ] } ] }, { "uniprot_ac": "Q8BTR5", "gene_name": "Dusp28", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q8BTR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTR5" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8BTR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTR5" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q8BTR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTR5" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8BTR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BTR5" } ] } ] }, { "uniprot_ac": "Q8BUM3", "gene_name": "Ptpn7", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8BUM3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BUM3" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8BUM3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BUM3" } ] } ] }, { "uniprot_ac": "Q8CE08", "gene_name": "Acp3", "activity": [ { "ec_number": "3.1.3.5", "activity": "A 5'-ribonucleotide + H(2)O = a ribonucleoside + phosphate.", "evidence": [ { "id": "Q8CE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CE08" } ] }, { "ec_number": "3.1.3.2", "activity": "A phosphate monoester + H(2)O = an alcohol + phosphate.", "evidence": [ { "id": "Q8CE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CE08" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8CE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CE08" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q8CE08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CE08" } ] } ] }, { "uniprot_ac": "Q8CGB6", "gene_name": "Tns2", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8CGB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CGB6" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8CGB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CGB6" } ] } ] }, { "uniprot_ac": "Q8CHP8", "gene_name": "Pgp", "activity": [ { "ec_number": "3.1.3.21", "activity": "sn-glycerol 1-phosphate + H(2)O = glycerol + phosphate.", "evidence": [ { "id": "Q8CHP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHP8" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8CHP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHP8" } ] }, { "ec_number": "3.1.3.21", "activity": "", "evidence": [ { "id": "Q8CHP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHP8" } ] } ] }, { "uniprot_ac": "Q8K296", "gene_name": "Mtmr3", "activity": [ { "ec_number": "3.1.3.64", "activity": "1-phosphatidyl-1D-myo-inositol 3-phosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol + phosphate.", "evidence": [ { "id": "Q8K296", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K296" } ] }, { "ec_number": "3.1.3.64", "activity": "", "evidence": [ { "id": "Q8K296", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K296" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8K296", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K296" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8K296", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K296" } ] }, { "ec_number": "3.1.3.95", "activity": "1-phosphatidyl-1D-myo-inositol 3,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate + phosphate.", "evidence": [ { "id": "Q8K296", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K296" } ] } ] }, { "uniprot_ac": "Q8K330", "gene_name": "Ssh3", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q8K330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K330" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8K330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K330" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8K330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K330" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q8K330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K330" } ] } ] }, { "uniprot_ac": "Q8K4T5", "gene_name": "Dusp19", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q8K4T5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4T5" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8K4T5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4T5" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8K4T5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4T5" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q8K4T5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4T5" } ] } ] }, { "uniprot_ac": "Q8NEJ0", "gene_name": "DUSP18", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8NEJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEJ0" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8NEJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEJ0" } ] }, { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q8NEJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEJ0" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q8NEJ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEJ0" } ] } ] }, { "uniprot_ac": "Q8R4V2", "gene_name": "Dusp15", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q8R4V2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4V2" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8R4V2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4V2" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q8R4V2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4V2" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8R4V2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R4V2" } ] } ] }, { "uniprot_ac": "Q8TE77", "gene_name": "SSH3", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q8TE77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TE77" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8TE77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TE77" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8TE77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TE77" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q8TE77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TE77" } ] } ] }, { "uniprot_ac": "Q8TF42", "gene_name": "UBASH3B", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8TF42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TF42" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8TF42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TF42" } ] } ] }, { "uniprot_ac": "Q8VE01", "gene_name": "Dusp18", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q8VE01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VE01" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8VE01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VE01" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q8VE01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VE01" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8VE01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VE01" } ] } ] }, { "uniprot_ac": "Q8WTR2", "gene_name": "DUSP19", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q8WTR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTR2" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8WTR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTR2" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8WTR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTR2" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q8WTR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTR2" } ] } ] }, { "uniprot_ac": "Q8WUK0", "gene_name": "PTPMT1", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q8WUK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WUK0" } ] }, { "ec_number": "3.1.3.27", "activity": "Phosphatidylglycerophosphate + H(2)O = phosphatidylglycerol + phosphate.", "evidence": [ { "id": "Q8WUK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WUK0" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8WUK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WUK0" } ] }, { "ec_number": "3.1.3.27", "activity": "", "evidence": [ { "id": "Q8WUK0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WUK0" } ] } ] }, { "uniprot_ac": "Q8WYL5", "gene_name": "SSH1", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q8WYL5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WYL5" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q8WYL5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WYL5" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q8WYL5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WYL5" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q8WYL5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WYL5" } ] } ] }, { "uniprot_ac": "Q91XQ2", "gene_name": "Epm2a", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q91XQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XQ2" } ] }, { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q91XQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XQ2" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q91XQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XQ2" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q91XQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XQ2" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q91XQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XQ2" } ] } ] }, { "uniprot_ac": "Q91XS1", "gene_name": "Mtmr4", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q91XS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XS1" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q91XS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91XS1" } ] } ] }, { "uniprot_ac": "Q91Z46", "gene_name": "Dusp7", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q91Z46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z46" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q91Z46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z46" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q91Z46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z46" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q91Z46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91Z46" } ] } ] }, { "uniprot_ac": "Q92729", "gene_name": "PTPRU", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q92729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92729" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q92729", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92729" } ] } ] }, { "uniprot_ac": "Q92932", "gene_name": "PTPRN2", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q92932", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92932" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q92932", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92932" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q92932", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92932" } ] } ] }, { "uniprot_ac": "Q93096", "gene_name": "PTP4A1", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q93096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q93096" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q93096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q93096" } ] } ] }, { "uniprot_ac": "Q99502", "gene_name": "EYA1", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q99502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99502" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q99502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99502" } ] }, { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q99502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99502" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q99502", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99502" } ] } ] }, { "uniprot_ac": "Q99504", "gene_name": "EYA3", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q99504", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99504" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q99504", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99504" } ] } ] }, { "uniprot_ac": "Q99952", "gene_name": "PTPN18", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q99952", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99952" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q99952", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99952" } ] } ] }, { "uniprot_ac": "Q99956", "gene_name": "DUSP9", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q99956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99956" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q99956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99956" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q99956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99956" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q99956", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99956" } ] } ] }, { "uniprot_ac": "Q99M80", "gene_name": "Ptprt", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q99M80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99M80" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q99M80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99M80" } ] } ] }, { "uniprot_ac": "Q99N11", "gene_name": "Dusp22", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q99N11", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99N11" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q99N11", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99N11" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q99N11", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99N11" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q99N11", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99N11" } ] } ] }, { "uniprot_ac": "Q9BV47", "gene_name": "DUSP26", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9BV47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BV47" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9BV47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BV47" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9BV47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BV47" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9BV47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BV47" } ] } ] }, { "uniprot_ac": "Q9BVJ7", "gene_name": "DUSP23", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9BVJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BVJ7" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9BVJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BVJ7" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9BVJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BVJ7" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9BVJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BVJ7" } ] } ] }, { "uniprot_ac": "Q9BY84", "gene_name": "DUSP16", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9BY84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY84" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9BY84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY84" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9BY84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY84" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9BY84", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY84" } ] } ] }, { "uniprot_ac": "Q9D0T2", "gene_name": "Dusp12", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9D0T2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D0T2" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9D0T2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D0T2" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9D0T2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D0T2" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9D0T2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D0T2" } ] } ] }, { "uniprot_ac": "Q9D358", "gene_name": "Acp1", "activity": [ { "ec_number": "3.1.3.2", "activity": "A phosphate monoester + H(2)O = an alcohol + phosphate.", "evidence": [ { "id": "Q9D358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D358" } ] }, { "ec_number": "3.1.3.2", "activity": "", "evidence": [ { "id": "Q9D358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D358" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9D358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D358" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9D358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D358" } ] } ] }, { "uniprot_ac": "Q9D658", "gene_name": "Ptp4a3", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9D658", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D658" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9D658", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D658" } ] } ] }, { "uniprot_ac": "Q9D700", "gene_name": "Dusp26", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9D700", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D700" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9D700", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D700" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9D700", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D700" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9D700", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D700" } ] } ] }, { "uniprot_ac": "Q9D7X3", "gene_name": "Dusp3", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9D7X3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D7X3" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9D7X3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D7X3" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9D7X3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D7X3" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9D7X3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D7X3" } ] } ] }, { "uniprot_ac": "Q9D967", "gene_name": "Mdp1", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9D967", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D967" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9D967", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D967" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9D967", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D967" } ] } ] }, { "uniprot_ac": "Q9D9D8", "gene_name": "Dusp21", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9D9D8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D9D8" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9D9D8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D9D8" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9D9D8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D9D8" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9D9D8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D9D8" } ] } ] }, { "uniprot_ac": "Q9DBB1", "gene_name": "Dusp6", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9DBB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBB1" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9DBB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBB1" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9DBB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBB1" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9DBB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBB1" } ] } ] }, { "uniprot_ac": "Q9ESS0", "gene_name": "Dusp10", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9ESS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESS0" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9ESS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESS0" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9ESS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESS0" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9ESS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESS0" } ] } ] }, { "uniprot_ac": "Q9H1R2", "gene_name": "DUSP15", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9H1R2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H1R2" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9H1R2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H1R2" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9H1R2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H1R2" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9H1R2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H1R2" } ] } ] }, { "uniprot_ac": "Q9H3S7", "gene_name": "PTPN23", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9H3S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H3S7" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9H3S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H3S7" } ] } ] }, { "uniprot_ac": "Q9H596", "gene_name": "DUSP21", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9H596", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H596" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9H596", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H596" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9H596", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H596" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9H596", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9H596" } ] } ] }, { "uniprot_ac": "Q9HD43", "gene_name": "PTPRH", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9HD43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HD43" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9HD43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HD43" } ] } ] }, { "uniprot_ac": "Q9JIM4", "gene_name": "Dusp12", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9JIM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIM4" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9JIM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIM4" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9JIM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIM4" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9JIM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIM4" } ] } ] }, { "uniprot_ac": "Q9JLY7", "gene_name": "Dusp14", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9JLY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLY7" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9JLY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLY7" } ] }, { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9JLY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLY7" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9JLY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JLY7" } ] } ] }, { "uniprot_ac": "Q9NRW4", "gene_name": "DUSP22", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9NRW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRW4" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9NRW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRW4" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9NRW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRW4" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9NRW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRW4" } ] } ] }, { "uniprot_ac": "Q9NYA4", "gene_name": "MTMR4", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9NYA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYA4" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9NYA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYA4" } ] } ] }, { "uniprot_ac": "Q9QYJ7", "gene_name": "Dusp13", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9QYJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYJ7" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9QYJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYJ7" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9QYJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYJ7" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9QYJ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYJ7" } ] } ] }, { "uniprot_ac": "Q9UII6", "gene_name": "DUSP13", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9UII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UII6" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9UII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UII6" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9UII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UII6" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9UII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UII6" } ] } ] }, { "uniprot_ac": "Q9UMZ3", "gene_name": "PTPRQ", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9UMZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UMZ3" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9UMZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UMZ3" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9UMZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UMZ3" } ] } ] }, { "uniprot_ac": "Q9UNH5", "gene_name": "CDC14A", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9UNH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNH5" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9UNH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNH5" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9UNH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNH5" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9UNH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNH5" } ] } ] }, { "uniprot_ac": "Q9UNI6", "gene_name": "DUSP12", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9UNI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNI6" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9UNI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNI6" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9UNI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNI6" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9UNI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNI6" } ] } ] }, { "uniprot_ac": "Q9VVW5", "gene_name": "Mkp3", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9VVW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VVW5" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9VVW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VVW5" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9VVW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VVW5" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9VVW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VVW5" } ] }, { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9VVW5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VVW5" } ] } ] }, { "uniprot_ac": "Q9VWF4", "gene_name": "MKP-4", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9VWF4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VWF4" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9VWF4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VWF4" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9VWF4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VWF4" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9VWF4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VWF4" } ] } ] }, { "uniprot_ac": "Q9W0G1", "gene_name": "Ptp61F", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9W0G1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W0G1" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9W0G1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W0G1" } ] } ] }, { "uniprot_ac": "Q9W0R3", "gene_name": "Ptpmeg", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9W0R3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W0R3" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9W0R3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W0R3" } ] } ] }, { "uniprot_ac": "Q9W4F5", "gene_name": "Ptp4E", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9W4F5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W4F5" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9W4F5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W4F5" } ] } ] }, { "uniprot_ac": "Q9WU22", "gene_name": "Ptpn4", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9WU22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WU22" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9WU22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WU22" } ] } ] }, { "uniprot_ac": "Q9WUA5", "gene_name": "Epm2a", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9WUA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUA5" } ] }, { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9WUA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUA5" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9WUA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUA5" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9WUA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUA5" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9WUA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUA5" } ] } ] }, { "uniprot_ac": "Q9Y2R2", "gene_name": "PTPN22", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9Y2R2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2R2" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9Y2R2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2R2" } ] } ] }, { "uniprot_ac": "Q9Y6W6", "gene_name": "DUSP10", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "Q9Y6W6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6W6" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9Y6W6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6W6" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9Y6W6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6W6" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "Q9Y6W6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y6W6" } ] } ] }, { "uniprot_ac": "Q9Z191", "gene_name": "Eya4", "activity": [ { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "Q9Z191", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z191" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q9Z191", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z191" } ] } ] }, { "uniprot_ac": "X2JEB8", "gene_name": "MKP-like", "activity": [ { "ec_number": "3.1.3.16", "activity": "[a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.", "evidence": [ { "id": "X2JEB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/X2JEB8" } ] }, { "ec_number": "3.1.3.48", "activity": "Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate.", "evidence": [ { "id": "X2JEB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/X2JEB8" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "X2JEB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/X2JEB8" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "X2JEB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/X2JEB8" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ] }