{ "uniprot_canonical_ac": "A2ADU8-1", "uniprot_ac": "A2ADU8", "uniprot_id": "DG2L6_MOUSE", "mass": { "chemical_mass": 38362.0, "monoisotopic_mass": 38362.0 }, "refseq": { "ac": "NP_001107556", "name": "diacylglycerol O-acyltransferase 2-like protein 6", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107556" }, "gene_names": [ { "name": "Dgat2l6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2ADU8", "id": "A2ADU8" }, { "name": "9930021F22Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107556", "id": "NP_001107556" }, { "name": "Dgat2l6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107556", "id": "NP_001107556" } ], "protein_names": [ { "name": "Diacylglycerol O-acyltransferase 2-like protein 6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2ADU8#names_and_taxonomy", "id": "A2ADU8" }, { "name": "2.3.1.-", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2ADU8#names_and_taxonomy", "id": "A2ADU8" }, { "name": "diacylglycerol O-acyltransferase 2-like protein 6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107556", "id": "NP_001107556" } ], "function": [ { "annotation": "Diglyceride acyltransferase that uses fatty acyl-CoA as substrate. Particularly active with oleate as a substrate. Has no wax synthase activity to produce wax esters.", "evidence": [ { "database": "UniProtKB", "id": "A2ADU8", "url": "https://www.uniprot.org/uniprot/A2ADU8#function" }, { "database": "PubMed", "id": "Q6ZPD8", "url": "https://glygen.org/publication/PubMed/Q6ZPD8" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2ADU8", "url": "https://www.uniprot.org/uniprot/A2ADU8" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Dgat2l6", "url": "https://www.uniprot.org/uniprot/A2ADU8", "locus": { "chromosome": "X", "start_pos": 100524838, "end_pos": 100546144, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000067597", "url": "https://www.ensembl.org/id/ENSMUSG00000067597" } ] } } ], "crossref": [ { "id": "ENSMUSG00000067597", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000067597", "database": "Bgee" }, { "id": "668257", "url": "https://www.ncbi.nlm.nih.gov/gene/668257", "database": "GeneID" }, { "id": "IPR007130", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007130", "database": "InterPro" }, { "id": "mmu:668257", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:668257", "database": "KEGG Pathway" }, { "id": "3045268", "url": "http://www.informatics.jax.org/marker/MGI:3045268", "database": "MGI" }, { "id": "GTWIRFF", "url": "https://omabrowser.org/oma/group/GTWIRFF/", "database": "OMA" }, { "id": "1347007at2759", "url": "http://www.orthodb.org/?query=1347007at2759", "database": "OrthoDB" }, { "id": "PF03982", "url": "http://pfam.xfam.org/family/PF03982", "database": "Pfam" }, { "id": "PR_A2ADU8", "url": "http://purl.obolibrary.org/obo/PR_A2ADU8", "database": "PRO" }, { "id": "R-MMU-1482883", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1482883", "database": "Reactome" }, { "id": "NP_001107556", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001107556", "database": "RefSeq" }, { "id": "38219", "url": "https://www.rhea-db.org/rhea/38219", "database": "Rhea" }, { "id": "A2ADU8", "url": "https://www.uniprot.org/uniprot/A2ADU8", "database": "UniProtKB" }, { "id": "A2ADU8-1", "url": "https://www.uniprot.org/uniprot/A2ADU8-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MAAFSCLDLQEGLRTLSILQWIPVYVLLGTLSILGMPYLLLFTTLWPLSVLFLVWIAYDWNTHIQDGRRSAWVRNWTLWKYFQSYFPVKLVKTHDLSPKHNYIILSHPHGILSYGAFINFATESTGFSRVFPSITPFLATLEGIFWIPFVRDYLMSLGICPVSKLSLTHKLTQKDSGNAVIIVPGGASESLLSRPGVSMIYLKKRQGFVKLALKTGAYLVPSYSFGENETYNQETFAEGTWLRFFQKNIQKIGKRILGINLCTIHGRGLTRGSWGFLPFNHPITTVVGEPLPVPKIPDPDKETVEKYLELYISALRKLFDQHKAEYGLSKTHELKIL", "length": 337, "header": "sp|A2ADU8-1|DG2L6_MOUSE Isoform 1 of Diacylglycerol O-acyltransferase 2-like protein 6 OS=Mus musculus OX=10090 GN=Dgat2l6 PE=3 SV=1 CANONICAL=A2ADU8-1" }, "isoforms": [ { "isoform_ac": "A2ADU8-1", "url": "https://www.uniprot.org/uniprot/A2ADU8#A2ADU8-1", "sequence": { "sequence": "MAAFSCLDLQEGLRTLSILQWIPVYVLLGTLSILGMPYLLLFTTLWPLSVLFLVWIAYDWNTHIQDGRRSAWVRNWTLWKYFQSYFPVKLVKTHDLSPKHNYIILSHPHGILSYGAFINFATESTGFSRVFPSITPFLATLEGIFWIPFVRDYLMSLGICPVSKLSLTHKLTQKDSGNAVIIVPGGASESLLSRPGVSMIYLKKRQGFVKLALKTGAYLVPSYSFGENETYNQETFAEGTWLRFFQKNIQKIGKRILGINLCTIHGRGLTRGSWGFLPFNHPITTVVGEPLPVPKIPDPDKETVEKYLELYISALRKLFDQHKAEYGLSKTHELKIL", "length": 337, "header": "sp|A2ADU8-1|DG2L6_MOUSE Isoform 1 of Diacylglycerol O-acyltransferase 2-like protein 6 OS=Mus musculus OX=10090 GN=Dgat2l6 PE=3 SV=1 CANONICAL=A2ADU8-1" }, "locus": { "chromosome": "X", "start_pos": 99589203, "end_pos": 99568529, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000037541", "url": "https://www.ensembl.org/id/ENSMUST00000037541" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000036845", "url": "https://www.ensembl.org/id/ENSMUSP00000036845" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "mmu:668257", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:668257", "resource": "KEGG Pathway" }, { "id": "R-MMU-1482883", "name": "Acyl chain remodeling of DAG and TAG", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1482883", "resource": "Reactome", "description": "Acyl chain remodeling of DAG and TAG" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZTG7-1", "protein_name": "Acyltransferase", "gene_name": "Dgat2l6", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAFFSRLDLHEGLRTLSVLQWIPVYVILGTLSILGIPYFLLFSTFWPLSVLFLAWVAYDWNTHSQDGRRSAWVRNWTLWKYFQSYFPVKLVKTHDLSPKHNYIILSHPHGILCYGAFINFATEATGFSRVFPSITPFLATLEGIFWIPFVRDYVMSMGICPVSELALKHQLTQRGSGNAVIIVPGGASEALLCCPGVSTVYLKKRKGFVKLALKTGAYLVPSYSFGENEAYNQETFPEGTWLRFFQKNFQKIGKRILGINFCTFHGRGLTRGSWGFLPFNHPITTVVGEPLPVPKILDPDKETVAKYFELYISALRKLFDQHKTKYDFSKTQELTII", "length": 337 }, "evidence": [ { "id": "79625", "url": "http://www.informatics.jax.org/homology/79625", "database": "MGI" }, { "id": "A2ADU8", "url": "https://omabrowser.org/oma/group/A2ADU8/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6ZPD8-1", "protein_name": "Diacylglycerol O-acyltransferase 2-like protein 6", "gene_name": "DGAT2L6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAFFSRLNLQEGLQTFFVLQWIPVYIFLGAIPILLIPYFLLFSKFWPLAVLSLAWLTYDWNTHSQGGRRSAWVRNWTLWKYFRNYFPVKLVKTHDLSPKHNYIIANHPHGILSFGVFINFATEATGIARIFPSITPFVGTLERIFWIPIVREYVMSMGVCPVSSSALKYLLTQKGSGNAVVIVVGGAAEALLCRPGASTLFLKQRKGFVKMALQTGAYLVPSYSFGENEVFNQETFPEGTWLRLFQKTFQDTFKKILGLNFCTFHGRGFTRGSWGFLPFNRPITTVVGEPLPIPRIKRPNQKTVDKYHALYISALRKLFDQHKVEYGLPETQELTIT", "length": 337 }, "evidence": [ { "id": "79625", "url": "http://www.informatics.jax.org/homology/79625", "database": "MGI" }, { "id": "A2ADU8", "url": "https://omabrowser.org/oma/group/A2ADU8/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "A2ADU8", "url": "https://www.uniprot.org/uniprot/A2ADU8" } ], "pmid": "21873635" }, { "name": "monoacylglycerol biosynthetic process", "id": "GO:0006640", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006640", "evidence": [ { "database": "UniProtKB", "id": "A2ADU8", "url": "https://www.uniprot.org/uniprot/A2ADU8" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "integral component of membrane", "id": "GO:0016021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "evidence": [ { "database": "UniProtKB", "id": "A2ADU8", "url": "https://www.uniprot.org/uniprot/A2ADU8" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "A2ADU8", "url": "https://www.uniprot.org/uniprot/A2ADU8" } ], "pmid": "21873635" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "O-acyltransferase activity", "id": "GO:0008374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008374", "evidence": [ { "database": "UniProtKB", "id": "A2ADU8", "url": "https://www.uniprot.org/uniprot/A2ADU8" } ], "pmid": "21873635" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 228, "end_pos": 230, "annotation": "n_glycosylation_sequon" }, { "start_pos": 75, "end_pos": 77, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "38219", "name": "", "equation": "(9Z)-octadecenoyl-CoA + 1,2-di-(9Z-octadecenoyl)-sn-glycerol = 1,2,3-tri-(9Z-octadecenoyl)-glycerol + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9ERM3-1", "Q5FVP8-1", "Q86VF5-1", "Q58HT5-1", "Q6E213-1", "O75907-1", "Q96PD7-1", "Q6ZPD8-1", "Q3SYC2-1", "Q9DCV3-1", "Q6E1M8-1", "A2ADU8-1", "A2ADU9-1", "Q80W94-1", "Q9Z2A7-1" ], "evidence": [ { "id": "38219", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38219" } ] }, { "id": "R-MMU-8848580", "name": "DGAT2L6,L7P transfer acyl group from acyl-CoA to DAG, forming TAG", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A2ADU8-1" ], "evidence": [ { "id": "R-MMU-8848580", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8848580" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A2ADU8", "gene_name": "Dgat2l6", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "A2ADU8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2ADU8" } ] } ] }, { "uniprot_ac": "A2ADU9", "gene_name": "Awat1", "activity": [ { "ec_number": "2.3.1.75", "activity": "Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester.", "evidence": [ { "id": "A2ADU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2ADU9" } ] }, { "ec_number": "2.3.1.75", "activity": "", "evidence": [ { "id": "A2ADU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2ADU9" } ] } ] }, { "uniprot_ac": "O75907", "gene_name": "DGAT1", "activity": [ { "ec_number": "2.3.1.20", "activity": "Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol.", "evidence": [ { "id": "O75907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75907" } ] }, { "ec_number": "2.3.1.76", "activity": "Acyl-CoA + retinol = CoA + retinyl ester.", "evidence": [ { "id": "O75907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75907" } ] }, { "ec_number": "2.3.1.20", "activity": "", "evidence": [ { "id": "O75907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75907" } ] } ] }, { "uniprot_ac": "Q3SYC2", "gene_name": "MOGAT2", "activity": [ { "ec_number": "2.3.1.22", "activity": "Acyl-CoA + 2-acylglycerol = CoA + diacylglycerol.", "evidence": [ { "id": "Q3SYC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3SYC2" } ] }, { "ec_number": "2.3.1.22", "activity": "", "evidence": [ { "id": "Q3SYC2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3SYC2" } ] } ] }, { "uniprot_ac": "Q58HT5", "gene_name": "AWAT1", "activity": [ { "ec_number": "2.3.1.75", "activity": "Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester.", "evidence": [ { "id": "Q58HT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q58HT5" } ] }, { "ec_number": "2.3.1.75", "activity": "", "evidence": [ { "id": "Q58HT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q58HT5" } ] } ] }, { "uniprot_ac": "Q5FVP8", "gene_name": "Dgat2", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q5FVP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FVP8" } ] }, { "ec_number": "2.3.1.20", "activity": "Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol.", "evidence": [ { "id": "Q5FVP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FVP8" } ] }, { "ec_number": "2.3.1.76", "activity": "Acyl-CoA + retinol = CoA + retinyl ester.", "evidence": [ { "id": "Q5FVP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FVP8" } ] }, { "ec_number": "2.3.1.20", "activity": "", "evidence": [ { "id": "Q5FVP8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FVP8" } ] } ] }, { "uniprot_ac": "Q6E1M8", "gene_name": "Awat2", "activity": [ { "ec_number": "2.3.1.75", "activity": "Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester.", "evidence": [ { "id": "Q6E1M8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6E1M8" } ] }, { "ec_number": "2.3.1.76", "activity": "Acyl-CoA + retinol = CoA + retinyl ester.", "evidence": [ { "id": "Q6E1M8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6E1M8" } ] }, { "ec_number": "2.3.1.75", "activity": "", "evidence": [ { "id": "Q6E1M8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6E1M8" } ] } ] }, { "uniprot_ac": "Q6E213", "gene_name": "AWAT2", "activity": [ { "ec_number": "2.3.1.75", "activity": "Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester.", "evidence": [ { "id": "Q6E213", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6E213" } ] }, { "ec_number": "2.3.1.76", "activity": "Acyl-CoA + retinol = CoA + retinyl ester.", "evidence": [ { "id": "Q6E213", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6E213" } ] }, { "ec_number": "2.3.1.75", "activity": "", "evidence": [ { "id": "Q6E213", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6E213" } ] } ] }, { "uniprot_ac": "Q6ZPD8", "gene_name": "DGAT2L6", "activity": [ { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q6ZPD8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZPD8" } ] } ] }, { "uniprot_ac": "Q80W94", "gene_name": "Mogat2", "activity": [ { "ec_number": "2.3.1.22", "activity": "Acyl-CoA + 2-acylglycerol = CoA + diacylglycerol.", "evidence": [ { "id": "Q80W94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W94" } ] }, { "ec_number": "2.3.1.22", "activity": "", "evidence": [ { "id": "Q80W94", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80W94" } ] } ] }, { "uniprot_ac": "Q86VF5", "gene_name": "MOGAT3", "activity": [ { "ec_number": "2.3.1.20", "activity": "Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol.", "evidence": [ { "id": "Q86VF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86VF5" } ] }, { "ec_number": "2.3.1.22", "activity": "Acyl-CoA + 2-acylglycerol = CoA + diacylglycerol.", "evidence": [ { "id": "Q86VF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86VF5" } ] }, { "ec_number": "2.3.1.22", "activity": "", "evidence": [ { "id": "Q86VF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86VF5" } ] }, { "ec_number": "2.3.1.20", "activity": "", "evidence": [ { "id": "Q86VF5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86VF5" } ] } ] }, { "uniprot_ac": "Q96PD7", "gene_name": "DGAT2", "activity": [ { "ec_number": "2.3.1.20", "activity": "Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol.", "evidence": [ { "id": "Q96PD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PD7" } ] }, { "ec_number": "2.3.1.76", "activity": "Acyl-CoA + retinol = CoA + retinyl ester.", "evidence": [ { "id": "Q96PD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PD7" } ] }, { "ec_number": "2.3.1.20", "activity": "", "evidence": [ { "id": "Q96PD7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96PD7" } ] } ] }, { "uniprot_ac": "Q9DCV3", "gene_name": "Dgat2", "activity": [ { "ec_number": "2.3.1.20", "activity": "Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol.", "evidence": [ { "id": "Q9DCV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCV3" } ] }, { "ec_number": "2.3.1.76", "activity": "Acyl-CoA + retinol = CoA + retinyl ester.", "evidence": [ { "id": "Q9DCV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCV3" } ] }, { "ec_number": "2.3.1.20", "activity": "", "evidence": [ { "id": "Q9DCV3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCV3" } ] } ] }, { "uniprot_ac": "Q9ERM3", "gene_name": "Dgat1", "activity": [ { "ec_number": "2.3.1.20", "activity": "Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol.", "evidence": [ { "id": "Q9ERM3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERM3" } ] }, { "ec_number": "2.3.1.76", "activity": "Acyl-CoA + retinol = CoA + retinyl ester.", "evidence": [ { "id": "Q9ERM3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERM3" } ] }, { "ec_number": "2.3.1.20", "activity": "", "evidence": [ { "id": "Q9ERM3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERM3" } ] } ] }, { "uniprot_ac": "Q9Z2A7", "gene_name": "Dgat1", "activity": [ { "ec_number": "2.3.1.20", "activity": "Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol.", "evidence": [ { "id": "Q9Z2A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A7" } ] }, { "ec_number": "2.3.1.76", "activity": "Acyl-CoA + retinol = CoA + retinyl ester.", "evidence": [ { "id": "Q9Z2A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A7" } ] }, { "ec_number": "2.3.1.20", "activity": "", "evidence": [ { "id": "Q9Z2A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2A7" } ] } ] } ], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ] }