{ "uniprot_canonical_ac": "A2A591-1", "uniprot_ac": "A2A591", "uniprot_id": "KRA31_MOUSE", "mass": { "chemical_mass": 10271.0, "monoisotopic_mass": 10271.0 }, "refseq": { "ac": "NP_076000", "name": "keratin-associated protein 3-1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076000" }, "gene_names": [ { "name": "Krtap3-1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2A591", "id": "A2A591" }, { "name": "2310003K17Rik; KAP3.1; KRTAP3.1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076000", "id": "NP_076000" }, { "name": "Krtap3-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076000", "id": "NP_076000" } ], "protein_names": [ { "name": "Keratin-associated protein 3-1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A2A591#names_and_taxonomy", "id": "A2A591" }, { "name": "High-sulfur keratin protein", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A2A591#names_and_taxonomy", "id": "A2A591" }, { "name": "high-sulfur keratin protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076000", "id": "NP_076000" }, { "name": "keratin-associated protein 3-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076000", "id": "NP_076000" } ], "function": [ { "annotation": "In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "A2A591", "url": "https://www.uniprot.org/uniprot/A2A591#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2A591", "url": "https://www.uniprot.org/uniprot/A2A591" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Krtap3-1", "url": "https://www.uniprot.org/uniprot/A2A591", "locus": { "chromosome": "11", "start_pos": 99566630, "end_pos": 99566027, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000047564", "url": "https://www.ensembl.org/id/ENSMUSG00000047564" } ] } } ], "crossref": [ { "id": "ENSMUSG00000047564", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000047564", "database": "Bgee" }, { "id": "69473", "url": "https://www.ncbi.nlm.nih.gov/gene/69473", "database": "GeneID" }, { "id": "IPR007659", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007659", "database": "InterPro" }, { "id": "mmu:69473", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69473", "database": "KEGG Pathway" }, { "id": "1916723", "url": "http://www.informatics.jax.org/marker/MGI:1916723", "database": "MGI" }, { "id": "PGMSGIN", "url": "https://omabrowser.org/oma/group/PGMSGIN/", "database": "OMA" }, { "id": "1591683at2759", "url": "http://www.orthodb.org/?query=1591683at2759", "database": "OrthoDB" }, { "id": "PTHR23260", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23260", "database": "PANTHER" }, { "id": "PF04579", "url": "http://pfam.xfam.org/family/PF04579", "database": "Pfam" }, { "id": "PR_A2A591", "url": "http://purl.obolibrary.org/obo/PR_A2A591", "database": "PRO" }, { "id": "R-MMU-6805567", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6805567", "database": "Reactome" }, { "id": "NP_076000", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076000", "database": "RefSeq" }, { "id": "A2A591", "url": "https://www.uniprot.org/uniprot/A2A591", "database": "UniProtKB" }, { "id": "A2A591-1", "url": "https://www.uniprot.org/uniprot/A2A591-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MACCVARCCSVPTGPATTICSSDKSCRCGVCLPSTCPHEISLLQPTCCDPCPPPCCQPEVYVPTCWLLNSCHPTPGLSGINLTTYVQPGCESPCEPCC", "length": 98, "header": "sp|A2A591-1|KRA31_MOUSE Isoform 1 of Keratin-associated protein 3-1 OS=Mus musculus OX=10090 GN=Krtap3-1 PE=3 SV=1 CANONICAL=A2A591-1" }, "isoforms": [ { "isoform_ac": "A2A591-1", "url": "https://www.uniprot.org/uniprot/A2A591#A2A591-1", "sequence": { "sequence": "MACCVARCCSVPTGPATTICSSDKSCRCGVCLPSTCPHEISLLQPTCCDPCPPPCCQPEVYVPTCWLLNSCHPTPGLSGINLTTYVQPGCESPCEPCC", "length": 98, "header": "sp|A2A591-1|KRA31_MOUSE Isoform 1 of Keratin-associated protein 3-1 OS=Mus musculus OX=10090 GN=Krtap3-1 PE=3 SV=1 CANONICAL=A2A591-1" }, "locus": { "chromosome": "11", "start_pos": 99457409, "end_pos": 99457116, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000055502", "url": "https://www.ensembl.org/id/ENSMUST00000055502" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000053940", "url": "https://www.ensembl.org/id/ENSMUSP00000053940" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "mmu:69473", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69473", "resource": "KEGG Pathway" }, { "id": "R-MMU-6805567", "name": "Keratinization", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6805567", "resource": "Reactome", "description": "Keratinization" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZZR8-1", "protein_name": "Keratin-associated protein 3-1", "gene_name": "Krtap3-1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MACCVARCCSVPTGPATTICSSDKSCRCGVCLPSTCPHEISLLQPTCCDPCPPPCCQPEVYVPTCWLLNSCHPTPGLSGINLTTYVQPGCENPCEPCC", "length": 98 }, "evidence": [ { "id": "84874", "url": "http://www.informatics.jax.org/homology/84874", "database": "MGI" }, { "id": "A2A591", "url": "https://omabrowser.org/oma/group/A2A591/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9BYR8-1", "protein_name": "Keratin-associated protein 3-1", "gene_name": "KRTAP3-1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MYCCALRSCSVPTGPATTFCSFDKSCRCGVCLPSTCPHEISLLQPICCDTCPPPCCKPDTYVPTCWLLNNCHPTPGLSGINLTTYVQPGCESPCEPRC", "length": 98 }, "evidence": [ { "id": "84874", "url": "http://www.informatics.jax.org/homology/84874", "database": "MGI" }, { "id": "A2A591", "url": "https://omabrowser.org/oma/group/A2A591/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "structural molecule activity", "id": "GO:0005198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005198", "evidence": [ { "database": "UniProtKB", "id": "A2A591", "url": "https://www.uniprot.org/uniprot/A2A591" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "keratin filament", "id": "GO:0045095", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045095", "evidence": [ { "database": "UniProtKB", "id": "A2A591", "url": "https://www.uniprot.org/uniprot/A2A591" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 81, "end_pos": 83, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ] }