{ "uniprot_canonical_ac": "A1BPI0-1", "uniprot_ac": "A1BPI0", "uniprot_id": "OAZ3_RAT", "mass": { "chemical_mass": 28185.0, "monoisotopic_mass": 28185.0 }, "refseq": { "ac": "NP_001094488", "name": "ornithine decarboxylase antizyme 3", "summary": "The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamine levels. Expression of antizymes requires +1 ribosomal frameshifting, which is enhanced by high levels of polyamines. Antizymes in turn bind to and inhibit ornithine decarboxylase (ODC), the key enzyme in polyamine biosynthesis; thus, completing the auto-regulatory circuit. This gene encodes antizyme 3, the third member of the antizyme family. Like antizymes 1 and 2, antizyme 3 inhibits ODC activity and polyamine uptake; however, it does not stimulate ODC degradation. Also, while antizymes 1 and 2 have broad tissue distribution, expression of antizyme 3 is restricted to haploid germ cells in testis, suggesting a distinct role for this antizyme in spermiogenesis. Antizyme 3 gene knockout studies showed that homozygous mutant male mice were infertile, and indicated the likely role of this antizyme in the formation of a rigid connection between the sperm head and tail during spermatogenesis. This transcript initiates translation from a non-AUG (CUG) codon that is highly conserved among the antizyme 3 orthologs. [provided by RefSeq, Dec 2014].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488" }, "gene_names": [ { "name": "Oaz3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A1BPI0", "id": "A1BPI0" }, { "name": "Az3; Oaz-t; ODC-Az 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488", "id": "NP_001094488" }, { "name": "Oaz3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488", "id": "NP_001094488" } ], "protein_names": [ { "name": "Ornithine decarboxylase antizyme 3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A1BPI0#names_and_taxonomy", "id": "A1BPI0" }, { "name": "AZ3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A1BPI0#names_and_taxonomy", "id": "A1BPI0" }, { "name": "ODC-Az 3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A1BPI0#names_and_taxonomy", "id": "A1BPI0" }, { "name": "antizyme 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488", "id": "NP_001094488" }, { "name": "ornithine decarboxylase antizyme 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488", "id": "NP_001094488" } ], "function": [ { "annotation": "Does not possess antizyme activity. Modulates PPP1CB activity through its interaction with PPP1R16A.", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0#function" }, { "database": "PubMed", "id": "21712390", "url": "https://glygen.org/publication/PubMed/21712390" } ] }, { "annotation": "N-terminal protein sequencing suggests translation initiation from a non-AUG (CUG) start site.", "evidence": [ { "database": "RefSeq", "id": "NP_001094488", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488" }, { "database": "PubMed", "id": "17040916", "url": "https://glygen.org/publication/PubMed/17040916" } ] }, { "annotation": "Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis and uptake in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of the functional ODC homodimers. Does not target the ODC monomers for degradation, which allows a protein synthesis-independent restoration of ODC activity. Stabilizes AZIN2 by interfering with its ubiquitination. Involved in the translocation of AZNI2 from ER-Golgi intermediate compartment (ERGIC) to the cytosol. Probably plays a key role in spermatogenesis by regulating the intracellular concentration of polyamines in haploid germ cells (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0#function" }, { "database": "PubMed", "id": "Q9R109", "url": "https://glygen.org/publication/PubMed/Q9R109" }, { "database": "PubMed", "id": "Q9UMX2", "url": "https://glygen.org/publication/PubMed/Q9UMX2" } ] }, { "annotation": "Ornithine decarboxylase antizyme Oaz3 modulates protein phosphatase activity.", "evidence": [ { "database": "RefSeq", "id": "NP_001094488", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488" }, { "database": "PubMed", "id": "21712390", "url": "https://glygen.org/publication/PubMed/21712390" } ] }, { "annotation": "The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamine levels. Expression of antizymes requires +1 ribosomal frameshifting, which is enhanced by high levels of polyamines. Antizymes in turn bind to and inhibit ornithine decarboxylase (ODC), the key enzyme in polyamine biosynthesis; thus, completing the auto-regulatory circuit. This gene encodes antizyme 3, the third member of the antizyme family. Like antizymes 1 and 2, antizyme 3 inhibits ODC activity and polyamine uptake; however, it does not stimulate ODC degradation. Also, while antizymes 1 and 2 have broad tissue distribution, expression of antizyme 3 is restricted to haploid germ cells in testis, suggesting a distinct role for this antizyme in spermiogenesis. Antizyme 3 gene knockout studies showed that homozygous mutant male mice were infertile, and indicated the likely role of this antizyme in the formation of a rigid connection between the sperm head and tail during spermatogenesis. This transcript initiates translation from a non-AUG (CUG) codon that is highly conserved among the antizyme 3 orthologs. [provided by RefSeq, Dec 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_001094488", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" } ], "common_name": "Rat" } ], "gene": [ { "name": "Oaz3", "url": "https://www.uniprot.org/uniprot/A1BPI0", "locus": { "chromosome": "2", "start_pos": 195678848, "end_pos": 195676048, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000020863", "url": "https://www.ensembl.org/id/ENSRNOG00000020863" } ] } } ], "crossref": [ { "id": "ENSRNOG00000020863", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000020863", "database": "Bgee" }, { "id": "689588", "url": "https://www.ncbi.nlm.nih.gov/gene/689588", "database": "GeneID" }, { "id": "IPR002993", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002993", "database": "InterPro" }, { "id": "IPR016181", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016181", "database": "InterPro" }, { "id": "IPR029913", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029913", "database": "InterPro" }, { "id": "IPR038581", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038581", "database": "InterPro" }, { "id": "rno:689588", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:689588", "database": "KEGG Pathway" }, { "id": "YPLERDH", "url": "https://omabrowser.org/oma/group/YPLERDH/", "database": "OMA" }, { "id": "1403675at2759", "url": "http://www.orthodb.org/?query=1403675at2759", "database": "OrthoDB" }, { "id": "PTHR10279", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10279", "database": "PANTHER" }, { "id": "PTHR10279:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10279:SF9", "database": "PANTHER" }, { "id": "PF02100", "url": "http://pfam.xfam.org/family/PF02100", "database": "Pfam" }, { "id": "PR_A1BPI0", "url": "http://purl.obolibrary.org/obo/PR_A1BPI0", "database": "PRO" }, { "id": "R-RNO-350562", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-350562", "database": "Reactome" }, { "id": "NP_001094488", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488", "database": "RefSeq" }, { "id": "1599278", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1599278", "database": "RGD" }, { "id": "A0A096P6M0", "url": "https://www.uniprot.org/uniprot/A0A096P6M0", "database": "UniProtKB" }, { "id": "A0A096P6M0-1", "url": "https://www.uniprot.org/uniprot/A0A096P6M0-1", "database": "UniProtKB" }, { "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0", "database": "UniProtKB" }, { "id": "A1BPI0-1", "url": "https://www.uniprot.org/uniprot/A1BPI0-1", "database": "UniProtKB" }, { "id": "A1BPI0-2", "url": "https://www.uniprot.org/uniprot/A1BPI0-2", "database": "UniProtKB" }, { "id": "M0RB36", "url": "https://www.uniprot.org/uniprot/M0RB36", "database": "UniProtKB" }, { "id": "M0RB36-1", "url": "https://www.uniprot.org/uniprot/M0RB36-1", "database": "UniProtKB" } ], "sequence": { "sequence": "MPCTRSRPSLYSLSYIKRGKTRNCLYPFWSPYAYYLYCYKYRITLREKMLPCCYRSITYKEQEDLTLRPHCCLPCSCLPYSCLPCSESLEGLQVGRSTAQEKDHSQLKELYSAGNLTVLSADPLLHQDPVQLDFHFRLTPHSSAHWHGLLCDHQLFLDIPFQALEQGNRESLTATLEYVEEKTNVDSVFVNFQSNHKDRGALLRAFSYMGFEVVRPDHPALPPWDNVIFMVYPLERDLGQPGQ", "length": 243, "header": "sp|A1BPI0-1|OAZ3_RAT Isoform 1 of Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=1 CANONICAL=A1BPI0-1" }, "isoforms": [ { "isoform_ac": "A0A096P6M0-1", "url": "https://www.uniprot.org/uniprot/A1BPI0#A0A096P6M0-1", "sequence": { "sequence": "LPCTRSRPSLYSLSYIKRGKTRNCLYPFWSPYAYYLYCYKYRITLREKMLPCCYRSITYKEQEDLTLRPHCCLPCSCLPYSCLPCSESLEGLQVGRSTAQEKDHSQLKELYSAGNLTVLSADPLLHQDPVQLDFHFRLTPHSSAHWHGLLCDHQLFLDIPFQALEQGNRESLTATLEYVEEKTNVDSVFVNFQSNHKDRGALLRAFSYMGFEVVRPDHPALPPWDNVIFMVYPLERDLGQPGQ", "length": 243, "header": "tr|A0A096P6M0-1|A0A096P6M0_RAT Computationally mapped isoform of Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=2 CANONICAL=A1BPI0-1" }, "locus": { "chromosome": "2", "start_pos": 195678848, "end_pos": 195676048, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000028303", "url": "https://www.ensembl.org/id/ENSRNOT00000028303" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000028303", "url": "https://www.ensembl.org/id/ENSRNOP00000028303" } ] } }, { "isoform_ac": "A1BPI0-1", "url": "https://www.uniprot.org/uniprot/A1BPI0#A1BPI0-1", "sequence": { "sequence": "MPCTRSRPSLYSLSYIKRGKTRNCLYPFWSPYAYYLYCYKYRITLREKMLPCCYRSITYKEQEDLTLRPHCCLPCSCLPYSCLPCSESLEGLQVGRSTAQEKDHSQLKELYSAGNLTVLSADPLLHQDPVQLDFHFRLTPHSSAHWHGLLCDHQLFLDIPFQALEQGNRESLTATLEYVEEKTNVDSVFVNFQSNHKDRGALLRAFSYMGFEVVRPDHPALPPWDNVIFMVYPLERDLGQPGQ", "length": 243, "header": "sp|A1BPI0-1|OAZ3_RAT Isoform 1 of Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=1 CANONICAL=A1BPI0-1" }, "locus": {} }, { "isoform_ac": "A1BPI0-2", "url": "https://www.uniprot.org/uniprot/A1BPI0#A1BPI0-2", "sequence": { "sequence": "MPCTRSRPSLYSLSYIKRGKTRNCLYPFWSPYAYYLYCYKYRITLREKMLPCCYRSITYKEQEDLTLRPHCCLPCSCLPYSCLPCS", "length": 86, "header": "sp|A1BPI0-2|OAZ3_RAT Isoform 2 of Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=1 CANONICAL=A1BPI0-1" }, "locus": {} }, { "isoform_ac": "M0RB36-1", "url": "https://www.uniprot.org/uniprot/A1BPI0#M0RB36-1", "sequence": { "sequence": "LPCTRSRPSLYSLSYIKRGNTELPLPILVTIRLLPLLLQIPDHPPGEDAALLLQKHHLQGTGGPDSPAPLLPPVLLPPVLLPPVLESLEGLQVGRSTAQEKDHSQ", "length": 105, "header": "tr|M0RB36-1|M0RB36_RAT Computationally mapped isoform of Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=1 CANONICAL=A1BPI0-1" }, "locus": { "chromosome": "2", "start_pos": 195678848, "end_pos": 195678268, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000075569", "url": "https://www.ensembl.org/id/ENSRNOT00000075569" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000066758", "url": "https://www.ensembl.org/id/ENSRNOP00000066758" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "Q703I1-1", "kinase_gene_name": "Oser1", "residue": "Ser", "comment": "", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" }, { "database": "iPTMnet", "id": "A1BPI0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A1BPI0" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "Q703I1-1", "kinase_gene_name": "Oser1", "residue": "Ser", "comment": "", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" }, { "database": "iPTMnet", "id": "A1BPI0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A1BPI0" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "Q703I1-1", "kinase_gene_name": "Oser1", "residue": "Ser", "comment": "", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" }, { "database": "iPTMnet", "id": "A1BPI0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A1BPI0" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] }, { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "glycation": [], "keywords": [], "publication": [ { "title": "Mammalian transcription in support of hybrid mRNA and protein synthesis in testis and lung.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "Cheng M., van der Hoorn F.A., Oko R., Dong K., Fitzgerald C., Lawson V., Sikora C.", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" }, { "database": "RefSeq", "id": "NP_001094488", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488" } ], "reference": [ { "type": "PubMed", "id": "17040916", "url": "https://glygen.org/publication/PubMed/17040916" } ] }, { "title": "Ornithine decarboxylase antizyme Oaz3 modulates protein phosphatase activity.", "journal": "J. Biol. Chem.", "date": "2011", "authors": "Ruan Y., Ou Y., Cheng M., van der Hoorn F.A., Oko R.", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" }, { "database": "RefSeq", "id": "NP_001094488", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001094488" } ], "reference": [ { "type": "PubMed", "id": "21712390", "url": "https://glygen.org/publication/PubMed/21712390" } ] }, { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nature communications", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" }, { "database": "UniProtKB", "id": "M0RB36", "url": "https://www.uniprot.org/uniprot/M0RB36" }, { "database": "UniProtKB", "id": "A0A096P6M0", "url": "https://www.uniprot.org/uniprot/A0A096P6M0" }, { "database": "iPTMnet", "id": "A1BPI0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A1BPI0" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [ { "id": "rno:689588", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:689588", "resource": "KEGG Pathway" }, { "id": "R-RNO-350562", "name": "Regulation of ornithine decarboxylase (ODC)", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-350562", "resource": "Reactome", "description": "Regulation of ornithine decarboxylase (ODC)" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9R109-1", "protein_name": "Ornithine decarboxylase antizyme 3", "gene_name": "Oaz3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPCNRSRPSLYSLSYIKRGKTRNYLYPFWSPFAYYLYCYKYRITLREKMLPCCYKSITYKEQEDLTLRPHCCLPCSCLPCSCLQCSESLGGLQVGRSTAQEKDHSQLKELYSAGNLTVLSTDPLLHQDPVQLDFHFRLTPHSSAHWHGLLCDHRLFLDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVNFQIDRKDRGALLRAFSYMGFEVVRPDHPALPPWDNVIFMVYPLERDLGHPGQ", "length": 243 }, "evidence": [ { "id": "9410", "url": "http://www.informatics.jax.org/homology/9410", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UMX2-1", "protein_name": "Ornithine decarboxylase antizyme 3", "gene_name": "OAZ3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPCKRCRPSVYSLSYIKRGKTRNYLYPIWSPYAYYLYCYKYRITLREKMLPRCYKSITYKEEEDLTLQPRSCLQCSESLVGLQEGKSTEQGNHDQLKELYSAGNLTVLATDPLLHQDPVQLDFHFRLTSQTSAHWHGLLCDRRLFLDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVNFQNDRNDRGALLRAFSYMGFEVVRPDHPALPPLDNVIFMVYPLERDVGHLPSEPP", "length": 235 }, "evidence": [ { "id": "9410", "url": "http://www.informatics.jax.org/homology/9410", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "regulation of phosphoprotein phosphatase activity", "id": "GO:0043666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043666", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" } ], "pmid": "21712390" }, { "name": "negative regulation of polyamine transmembrane transport", "id": "GO:1902268", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902268", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" } ], "pmid": "" }, { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" } ], "pmid": "" }, { "name": "positive regulation of intracellular protein transport", "id": "GO:0090316", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090316", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" } ], "pmid": "" }, { "name": "positive regulation of protein catabolic process", "id": "GO:0045732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045732", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" } ], "pmid": "21712390" }, { "name": "sperm flagellum", "id": "GO:0036126", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036126", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" } ], "pmid": "21712390" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "ornithine decarboxylase inhibitor activity", "id": "GO:0008073", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008073", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" } ], "pmid": "" }, { "name": "ankyrin repeat binding", "id": "GO:0071532", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071532", "evidence": [ { "database": "UniProtKB", "id": "A1BPI0", "url": "https://www.uniprot.org/uniprot/A1BPI0" } ], "pmid": "21712390" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 115, "end_pos": 117, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ] }