{ "uniprot_canonical_ac": "A2AM29-1", "ptm_annotation": [], "sequence": { "header": "sp|A2AM29-1|AF9_MOUSE Isoform 1 of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1", "length": 569, "sequence": "MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPKKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKADSNLLTVTSGQQDKKAPSKRPPASDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSMLPPFDDIVDPNDSDVEENMSSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS" }, "uniprot_id": "AF9_MOUSE", "glycation": [], "keywords": [], "species": [ { "common_name": "Mouse", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "reaction_enzymes": [], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/11439343", "type": "PubMed", "id": "11439343" } ], "title": "The polycomb protein MPc3 interacts with AF9, an MLL fusion partner in t(9;11)(p22;q23) acute leukemias.", "journal": "Oncogene", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "authors": "Gould G.C.D., Hemenway C.S., de Erkenez A.C.", "date": "2001" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/12242306", "type": "PubMed", "id": "12242306" } ], "title": "Mouse Af9 is a controller of embryo patterning, like Mll, whose human homologue fuses with Af9 after chromosomal translocation in leukemia.", "journal": "Molecular and cellular biology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207.2", "id": "NP_084207.2", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ], "authors": "Collins EC, Appert A, Ariza-McNaughton L, Pannell R, Yamada Y, Rabbitts TH", "date": "2002" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21183079", "type": "PubMed", "id": "21183079" } ], "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" }, { "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A2AM29", "id": "A2AM29", "database": "iPTMnet" } ], "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "date": "2010" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27071307", "type": "PubMed", "id": "27071307" } ], "title": "Rheb1 promotes tumor progression through mTORC1 in MLL-AF9-initiated murine acute myeloid leukemia.", "journal": "Journal of hematology & oncology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207.2", "id": "NP_084207.2", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ], "authors": "Gao Y, Gao J, Li M, Zheng Y, Wang Y, Zhang H, Wang W, Chu Y, Wang X, Xu M, Cheng T, Ju Z, Yuan W", "date": "2016" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27105114", "type": "PubMed", "id": "27105114" } ], "title": "Molecular Coupling of Histone Crotonylation and Active Transcription by AF9 YEATS Domain.", "journal": "Molecular cell", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207.2", "id": "NP_084207.2", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ], "authors": "Li Y, Sabari BR, Panchenko T, Wen H, Zhao D, Guan H, Wan L, Huang H, Tang Z, Zhao Y, Roeder RG, Shi X, Allis CD, Li H", "date": "2016" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27607576", "type": "PubMed", "id": "27607576" } ], "title": "Atg5-dependent autophagy contributes to the development of acute myeloid leukemia in an MLL-AF9-driven mouse model.", "journal": "Cell death & disease", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207.2", "id": "NP_084207.2", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ], "authors": "Liu Q, Chen L, Atkinson JM, Claxton DF, Wang HG", "date": "2016" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27626380", "type": "PubMed", "id": "27626380" } ], "title": "High-throughput discovery of novel developmental phenotypes.", "journal": "Nature", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ], "authors": "Dickinson ME, Flenniken AM, Ji X, Teboul L, Wong MD, White JK, Meehan TF, Weninger WJ, Westerberg H, Adissu H, Baker CN, Bower L, Brown JM, Caddle LB, Chiani F, Clary D, Cleak J, Daly MJ, Denegre JM, Doe B, Dolan ME, Edie SM, Fuchs H, Gailus-Durner V, Galli A, Gambadoro A, Gallegos J, Guo S, Horner NR, Hsu CW, Johnson SJ, Kalaga S, Keith LC, Lanoue L, Lawson TN, Lek M, Mark M, Marschall S, Mason J, McElwee ML, Newbigging S, Nutter LM, Peterson KA, Ramirez-Solis R, Rowland DJ, Ryder E, Samocha KE, Seavitt JR, Selloum M, Szoke-Kovacs Z, Tamura M, Trainor AG, Tudose I, Wakana S, Warren J, Wendling O, West DB, Wong L, Yoshiki A, MacArthur DG, Tocchini-Valentini GP, Gao X, Flicek P, Bradley A, Skarnes WC, Justice MJ, Parkinson HE, Moore M, Wells S, Braun RE, Svenson KL, de Angelis MH, Herault Y, Mohun T, Mallon AM, Henkelman RM, Brown SD, Adams DJ, Lloyd KC, McKerlie C, Beaudet AL, Bucan M, Murray SA", "date": "2016" } ], "uniprot_ac": "A2AM29", "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AM29", "type": "synonym", "resource": "RefSeq", "name": "2210011H10Rik; 2610012I03Rik; 3830408D16Rik; Af; Af9; D4Ertd321; D4Ertd321e" }, { "url": "https://www.uniprot.org/uniprot/A2AM29", "type": "synonym", "resource": "UniProtKB", "name": "Af9" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AM29", "type": "synonym", "resource": "RefSeq", "name": "Mllt3" }, { "url": "https://www.uniprot.org/uniprot/A2AM29", "type": "recommended", "resource": "UniProtKB", "name": "Mllt3" } ], "reactions": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2AM29#A2AM29-1", "isoform_ac": "A2AM29-1", "locus": { "end_pos": 87774018, "strand": "+", "start_pos": 88033095, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000078090", "id": "ENSMUST00000078090", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000077232", "id": "ENSMUSP00000077232", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A2AM29-1|AF9_MOUSE Isoform 1 of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1", "length": 569, "sequence": "MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPKKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKADSNLLTVTSGQQDKKAPSKRPPASDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSMLPPFDDIVDPNDSDVEENMSSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS" } }, { "url": "https://www.uniprot.org/uniprot/A2AM29#E9PXP8-1", "isoform_ac": "E9PXP8-1", "locus": { "end_pos": 87774018, "strand": "+", "start_pos": 87782319, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000148059", "id": "ENSMUST00000148059", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000131095", "id": "ENSMUSP00000131095", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|E9PXP8-1|E9PXP8_MOUSE Computationally mapped isoform of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=4 SV=1 CANONICAL=A2AM29-1", "length": 54, "sequence": "MTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS" } }, { "url": "https://www.uniprot.org/uniprot/A2AM29#E9Q3B8-1", "isoform_ac": "E9Q3B8-1", "locus": { "end_pos": 88011673, "strand": "+", "start_pos": 88032639, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000142454", "id": "ENSMUST00000142454", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000127376", "id": "ENSMUSP00000127376", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|E9Q3B8-1|E9Q3B8_MOUSE Computationally mapped isoform of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1", "length": 73, "sequence": "MCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRAWTEWRWLRSGC" } }, { "url": "https://www.uniprot.org/uniprot/A2AM29#Q3UIA3-1", "isoform_ac": "Q3UIA3-1", "locus": { "end_pos": 87774018, "strand": "+", "start_pos": 87791965, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000149357", "id": "ENSMUST00000149357", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000128366", "id": "ENSMUSP00000128366", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|Q3UIA3-1|AF9_MOUSE Computationally mapped isoform of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1", "length": 162, "sequence": "MKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS" } }, { "url": "https://www.uniprot.org/uniprot/A2AM29#Q9D2P1-1", "isoform_ac": "Q9D2P1-1", "locus": { "end_pos": 87774018, "strand": "+", "start_pos": 87791965, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000126353", "id": "ENSMUST00000126353", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000129523", "id": "ENSMUSP00000129523", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|Q9D2P1-1|Q9D2P1_MOUSE Computationally mapped isoform of Protein AF-9 OS=Mus musculus OX=10090 GN=Mllt3 PE=1 SV=1 CANONICAL=A2AM29-1", "length": 138, "sequence": "MKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:70122", "resource": "KEGG Pathway", "id": "mmu:70122", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-112382", "description": "Formation of RNA Pol II elongation complex", "resource": "Reactome", "id": "R-MMU-112382", "name": "Formation of RNA Pol II elongation complex" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-674695", "description": "RNA Polymerase II Pre-transcription Events", "resource": "Reactome", "id": "R-MMU-674695", "name": "RNA Polymerase II Pre-transcription Events" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-75955", "description": "RNA Polymerase II Transcription Elongation", "resource": "Reactome", "id": "R-MMU-75955", "name": "RNA Polymerase II Transcription Elongation" } ], "reaction_participants": [], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "annotation": "Af9 gene is required for normal embryogenesis in mice by controlling pattern formation, apparently via control of Hox gene regulation", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207.2", "annotation": "Af9 gene is required for normal embryogenesis in mice by controlling pattern formation, apparently via control of Hox gene regulation", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207.2", "id": "NP_084207.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "annotation": "Atg5-dependent autophagy contributes to the development of acute myeloid leukemia in an MLL-AF9-driven mouse model. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207.2", "annotation": "Atg5-dependent autophagy contributes to the development of acute myeloid leukemia in an MLL-AF9-driven mouse model. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207.2", "id": "NP_084207.2", "database": "RefSeq" } ] }, { "url": "https://www.uniprot.org/uniprot/A2AM29#function", "annotation": "Chromatin reader component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA. Specifically recognizes and binds acylated histone H3, with a preference for histone H3 that is crotonylated. Crotonylation marks active promoters and enhancers and confers resistance to transcriptional repressors. Recognizes and binds histone H3 crotonylated at 'Lys-9' (H3K9cr), and with slightly lower affinity histone H3 crotonylated at 'Lys-18' (H3K18cr). Also recognizes and binds histone H3 acetylated and butyrylated at 'Lys-9' (H3K9ac and H3K9bu, respectively), but with lower affinity than crotonylated histone H3. In the SEC complex, MLLT3 is required to recruit the complex to crotonylated histones. Recruitment of the SEC complex to crotonylated histones promotes recruitment of DOT1L on active chromatin to deposit histone H3 'Lys-79' methylation (H3K79me). Plays a key role in hematopoietic stem cell (HSC) maintenance by preserving, rather than confering, HSC stemness. Acts by binding to the transcription start site of active genes in HSCs and sustaining level of H3K79me2, probably by recruiting DOT1L.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29#function", "id": "A2AM29", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "annotation": "Data suggest that RAS-homolog enriched in brain protein (Rheb1) promotes MLL-AF9 fusion protein initiated acute myeloid leukemia (AML) progression through target of rapamycin complex 1 (mTORC1) signaling pathway. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207.2", "annotation": "Data suggest that RAS-homolog enriched in brain protein (Rheb1) promotes MLL-AF9 fusion protein initiated acute myeloid leukemia (AML) progression through target of rapamycin complex 1 (mTORC1) signaling pathway. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207.2", "id": "NP_084207.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "annotation": "YEATS domain of AF9 directly links histone crotonylation to active transcription.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207.2", "annotation": "YEATS domain of AF9 directly links histone crotonylation to active transcription.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207.2", "id": "NP_084207.2", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2QC34-1", "protein_name": "MLLT3, super elongation complex subunit", "sequence": { "length": 500, "sequence": "MIVFMKRSSKPLLPSHHCLSVLQEEPKKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKADSNLLTVTSAQQDKKAPSKRPPVSDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSTLPPFDDIVDPNDSDVEENMSSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A2AM29/", "id": "A2AM29", "database": "OMA" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "gene_name": "Mllt3", "tax_id": 10116 }, { "uniprot_canonical_ac": "P42568-1", "protein_name": "Protein AF-9", "sequence": { "length": 568, "sequence": "MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKAPSKRPPISDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSTLPPFDDIVDPNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/37933", "id": "37933", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A2AM29/", "id": "A2AM29", "database": "OMA" } ], "common_name": "Human", "organism": "Homo sapiens", "gene_name": "MLLT3", "tax_id": 9606 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207.2", "ac": "NP_084207.2", "name": "protein AF-9 isoform 2", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "DNA binding", "id": "GO:0003677" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "chromatin binding", "id": "GO:0003682" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042393", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "histone binding", "id": "GO:0042393" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070577", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "lysine-acetylated histone binding", "id": "GO:0070577" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140030", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "modification-dependent protein binding", "id": "GO:0140030" } ], "total": 5, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "nucleoplasm", "id": "GO:0005654" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "cytosol", "id": "GO:0005829" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008023", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "transcription elongation factor complex", "id": "GO:0008023" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005694", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "chromosome", "id": "GO:0005694" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" } ], "total": 5, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009952", "pmid": "12242306", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "anterior/posterior pattern specification", "id": "GO:0009952" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007379", "pmid": "12242306", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "segment specification", "id": "GO:0007379" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090090", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "negative regulation of canonical Wnt signaling pathway", "id": "GO:0090090" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060218", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "hematopoietic stem cell differentiation", "id": "GO:0060218" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "positive regulation of transcription, DNA-templated", "id": "GO:0045893" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000096", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "positive regulation of Wnt signaling pathway, planar cell polarity pathway", "id": "GO:2000096" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000035", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "regulation of stem cell division", "id": "GO:2000035" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902275", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "regulation of chromatin organization", "id": "GO:1902275" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "name": "regulation of transcription, DNA-templated", "id": "GO:0006355" } ], "total": 9, "name": "Biological Process" } ] }, "site_annotation": [ { "end_pos": 145, "annotation": "n_glycosylation_sequon", "start_pos": 143 }, { "end_pos": 228, "annotation": "n_glycosylation_sequon", "start_pos": 226 }, { "end_pos": 365, "annotation": "n_glycosylation_sequon", "start_pos": 363 }, { "end_pos": 372, "annotation": "n_glycosylation_sequon", "start_pos": 370 }, { "end_pos": 430, "annotation": "n_glycosylation_sequon", "start_pos": 428 }, { "end_pos": 543, "annotation": "n_glycosylation_sequon", "start_pos": 541 } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000028496", "id": "ENSMUSG00000028496", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/70122", "id": "70122", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A2AM29*", "id": "A2AM29", "database": "IntAct" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR005033", "id": "IPR005033", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR038704", "id": "IPR038704", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR040930", "id": "IPR040930", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:70122", "id": "mmu:70122", "database": "KEGG Pathway" }, { "url": "http://www.informatics.jax.org/marker/MGI:1917372", "id": "1917372", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/MSKEPKA/", "id": "MSKEPKA", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=727038at2759", "id": "727038at2759", "database": "OrthoDB" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23195", "id": "PTHR23195", "database": "PANTHER" }, { "url": "http://pfam.xfam.org/family/PF03366", "id": "PF03366", "database": "Pfam" }, { "url": "http://pfam.xfam.org/family/PF17793", "id": "PF17793", "database": "Pfam" }, { "url": "http://purl.obolibrary.org/obo/PR_PR_A2AM29", "id": "PR_A2AM29", "database": "PRO" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-112382", "id": "R-MMU-112382", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-674695", "id": "R-MMU-674695", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-75955", "id": "R-MMU-75955", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602", "id": "NP_081602", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081602.3", "id": "NP_081602.3", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207", "id": "NP_084207", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084207.2", "id": "NP_084207.2", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A2AM29-1", "id": "A2AM29-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/E9PXP8", "id": "E9PXP8", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/E9PXP8-1", "id": "E9PXP8-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/E9Q3B8", "id": "E9Q3B8", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/E9Q3B8-1", "id": "E9Q3B8-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/Q3UIA3", "id": "Q3UIA3", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/Q3UIA3-1", "id": "Q3UIA3-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/Q9D2P1", "id": "Q9D2P1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/Q9D2P1-1", "id": "Q9D2P1-1", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [ { "residue": "Ser", "comment": "Phosphoserine", "kinase_gene_name": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "start_pos": 289, "end_pos": 289, "kinase_uniprot_canonical_ac": "" }, { "residue": "Ser", "comment": "Phosphoserine", "kinase_gene_name": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "start_pos": 295, "end_pos": 295, "kinase_uniprot_canonical_ac": "" }, { "residue": "Ser", "comment": "", "kinase_gene_name": "Atxn7l3b", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" }, { "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A2AM29", "id": "A2AM29", "database": "iPTMnet" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21183079", "id": "21183079", "database": "PubMed" } ], "start_pos": 413, "end_pos": 413, "kinase_uniprot_canonical_ac": "Q3UD01-1" }, { "residue": "Ser", "comment": "Phosphoserine", "kinase_gene_name": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21183079", "id": "21183079", "database": "PubMed" } ], "start_pos": 413, "end_pos": 413, "kinase_uniprot_canonical_ac": "" }, { "residue": "Ser", "comment": "Phosphoserine", "kinase_gene_name": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "start_pos": 420, "end_pos": 420, "kinase_uniprot_canonical_ac": "" }, { "residue": "Ser", "comment": "Phosphoserine", "kinase_gene_name": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "id": "A2AM29", "database": "UniProtKB" } ], "start_pos": 484, "end_pos": 484, "kinase_uniprot_canonical_ac": "" } ], "mass": { "monoisotopic_mass": 63375.0, "chemical_mass": 63375.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2AM29", "name": "Mllt3", "locus": { "end_pos": 87769925, "strand": "-", "start_pos": 88033364, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000028496", "id": "ENSMUSG00000028496", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A2AM29#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein homolog" }, { "url": "https://www.uniprot.org/uniprot/A2AM29#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Protein AF-9" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AM29", "type": "synonym", "resource": "RefSeq", "name": "myeloid/lymphoid or mixed lineage-leukemia translocation to 3 homolog; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 3; myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein homolog; protein AF-9" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AM29", "type": "synonym", "resource": "RefSeq", "name": "protein AF-9 isoform 1" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AM29", "type": "synonym", "resource": "RefSeq", "name": "protein AF-9 isoform 2" } ] }