{ "uniprot_canonical_ac": "A1E960-1", "ptm_annotation": [ { "annotation": "O-glycosylated.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ] } ], "sequence": { "header": "sp|A1E960-1|ODAM_MOUSE Isoform 1 of Odontogenic ameloblast-associated protein OS=Mus musculus OX=10090 GN=Odam PE=2 SV=1 CANONICAL=A1E960-1", "length": 273, "sequence": "MKIIILLGLIGASSSAPLISQRLLSASNSHELLLNLNNGQLLPLQFQGAFNSWIPPFPGFLQQQQAQVSGRPQFTLSTLESFAGLFPNQIPLSRQVGLAQGGQAGQPDLSQQQTPPQTQQSASPMSYVVPVKVPQDQTQMFQYYPVYMLLPWEQPQTVTSSPQHTGQQLFEEQIPFYNQFGFAPPQAEPGVPGGQQHLAFDSFVGTAPETPGMPVEGSLLYPQKEPISFKHDNAGVFMPTTSPKPSTDNFFTSGIDPTIAPEQKVKTDSLREP" }, "uniprot_id": "ODAM_MOUSE", "glycation": [], "keywords": [ "glycoprotein", "predicted.uniprotkb_gly" ], "species": [ { "common_name": "Mouse", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "reaction_enzymes": [], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/13679022", "type": "PubMed", "id": "13679022" } ], "title": "Multispecies comparative analysis of a mammalian-specific genomic domain encoding secretory proteins.", "journal": "Genomics", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" } ], "authors": "Rijnkels M, Elnitski L, Miller W, Rosen JM", "date": "2003" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/16674676", "type": "PubMed", "id": "16674676" } ], "title": "Identification of secreted and membrane proteins in the rat incisor enamel organ using a signal-trap screening approach.", "journal": "European journal of oral sciences", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" } ], "authors": "Moffatt P, Smith CE, Sooknanan R, St-Arnaud R, Nanci A", "date": "2006" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/17647262", "type": "PubMed", "id": "17647262" } ], "title": "Characterization of Apin, a secreted protein highly expressed in tooth-associated epithelia.", "journal": "J. Cell. Biochem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" } ], "authors": "Smith C.E., St Arnaud R., Moffatt P., Nanci A.", "date": "2008" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/20665536", "type": "PubMed", "id": "20665536" } ], "title": "The odontogenic ameloblast-associated protein (ODAM) cooperates with RUNX2 and modulates enamel mineralization via regulation of MMP-20.", "journal": "Journal of cellular biochemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" } ], "authors": "Lee HK, Lee DS, Ryoo HM, Park JT, Park SJ, Bae HS, Cho MI, Park JC", "date": "2010" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/22213140", "type": "PubMed", "id": "22213140" } ], "title": "Odontogenic ameloblasts-associated protein (ODAM), via phosphorylation by bone morphogenetic protein receptor type IB (BMPR-IB), is implicated in ameloblast differentiation.", "journal": "Journal of cellular biochemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" } ], "authors": "Lee HK, Park JT, Cho YS, Bae HS, Cho MI, Park JC", "date": "2012" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/22231912", "type": "PubMed", "id": "22231912" } ], "title": "Odontogenic ameloblast-associated and amelotin are novel basal lamina components.", "journal": "Histochemistry and cell biology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" } ], "authors": "Dos Santos Neves J, Wazen RM, Kuroda S, Francis Zalzal S, Moffatt P, Nanci A", "date": "2012" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/22387195", "type": "PubMed", "id": "22387195" } ], "title": "Expression pattern, subcellular localization, and functional implications of ODAM in ameloblasts, odontoblasts, osteoblasts, and various cancer cells.", "journal": "Gene expression patterns : GEP", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" } ], "authors": "Lee HK, Park SJ, Oh HJ, Kim JW, Bae HS, Park JC", "date": "2012" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/28436474", "type": "PubMed", "id": "28436474" } ], "title": "Interactions of AMTN, ODAM and SCPPPQ1 proteins of a specialized basal lamina that attaches epithelial cells to tooth mineral.", "journal": "Scientific reports", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" } ], "authors": "Fouillen A, Dos Santos Neves J, Mary C, Castonguay JD, Moffatt P, Baron C, Nanci A", "date": "2017" } ], "uniprot_ac": "A1E960", "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A1E960", "type": "synonym", "resource": "RefSeq", "name": "2310011G06Rik; APIN" }, { "url": "https://www.uniprot.org/uniprot/A1E960", "type": "synonym", "resource": "UniProtKB", "name": "Apin" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1E960", "type": "synonym", "resource": "RefSeq", "name": "Odam" }, { "url": "https://www.uniprot.org/uniprot/A1E960", "type": "recommended", "resource": "UniProtKB", "name": "Odam" } ], "reactions": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1E960#A1E960-1", "isoform_ac": "A1E960-1", "locus": { "end_pos": 87885712, "strand": "-", "start_pos": 87892709, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000113274", "id": "ENSMUST00000113274", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000108899", "id": "ENSMUSP00000108899", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A1E960-1|ODAM_MOUSE Isoform 1 of Odontogenic ameloblast-associated protein OS=Mus musculus OX=10090 GN=Odam PE=2 SV=1 CANONICAL=A1E960-1", "length": 273, "sequence": "MKIIILLGLIGASSSAPLISQRLLSASNSHELLLNLNNGQLLPLQFQGAFNSWIPPFPGFLQQQQAQVSGRPQFTLSTLESFAGLFPNQIPLSRQVGLAQGGQAGQPDLSQQQTPPQTQQSASPMSYVVPVKVPQDQTQMFQYYPVYMLLPWEQPQTVTSSPQHTGQQLFEEQIPFYNQFGFAPPQAEPGVPGGQQHLAFDSFVGTAPETPGMPVEGSLLYPQKEPISFKHDNAGVFMPTTSPKPSTDNFFTSGIDPTIAPEQKVKTDSLREP" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69592", "resource": "KEGG Pathway", "id": "mmu:69592", "name": "" } ], "reaction_participants": [], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "annotation": "Data suggest that amelotin (AMTN), odontogenic ameloblast-associated protein (ODAM) and secretory calcium-binding phosphoprotein proline-glutamine rich 1 (SCPPPQ1) participate in structuring an extracellular matrix with the distinctive capacity of attaching epithelial cells to mineralized surfaces. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "annotation": "ODAM and AMTN are bona fide components of the basal lamina associated with maturation stage ameloblasts and they organize into different subdomains during the early maturation stage.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "annotation": "Runx2 regulates the expression of ODAM and nuclear ODAM serves an important regulatory function in the mineralization of enamel through the regulation of MMP-20 apart from a different, currently unidentified, function of extracellular ODAM.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "annotation": "The BMP-2-BMPR-IB-ODAM-MAPK signaling cascade has important roles in ameloblast differentiation and enamel mineralization", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "annotation": "The protein sequences deduced from the cloned cDNA for rat, mouse, pig, and human were aligned together with those obtained from four other mammal genomes. Apin is highly conserved in mammals.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" } ] }, { "url": "https://www.uniprot.org/uniprot/A1E960#function", "annotation": "Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involved in the induction of RHOA activity via interaction with ARHGEF and expression of downstream factors such as ROCK. Plays a role in attachment of the junctional epithelium to the tooth surface.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960#function", "id": "A1E960", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "annotation": "We propose that ODAM has diverse functions that vary with protein location in various cell lines. Nuclear ODAM appears to be associated with MMP-20 regulation and tumorigenesis. Additional functions may take place in cytoplasm and extracellular matrix.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "A1E959-1", "protein_name": "Odontogenic ameloblast-associated protein", "sequence": { "length": 279, "sequence": "MKIIILLGFLGATLSAPLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/49511", "id": "49511", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A1E960/", "id": "A1E960", "database": "OMA" } ], "common_name": "Human", "organism": "Homo sapiens", "gene_name": "ODAM", "tax_id": 9606 }, { "uniprot_canonical_ac": "Q3HS83-1", "protein_name": "Odontogenic ameloblast-associated protein", "sequence": { "length": 278, "sequence": "MKIIILLGLIGATSSAPLITQRLLSASNSHELLLNLNNGQLLPLQFQSAFNSWIPPFPGLLQQQQQQAQVSGHPQFPLSTLESFAGLFPNQIPFSRQVGFAQGGQAGQPDFSQQQTPSQTQQASPMSYVVPVKVPQDQTQMFQYYPVYMLLPWEQPQQTVTSSPQQTGQQLYEEQIPFYNQFGFVPQQAEPGVPGGQQHLVLDSFVGTAPETPGMPAVEGPLYPQKEPIGFKQDNVGVSTPSTSPKPDTGNFFTSEINPTIAPLLPEQKVNADSLREP" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/49511", "id": "49511", "database": "MGI" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "gene_name": "Odam", "tax_id": 10116 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "ac": "NP_081404.2", "name": "odontogenic ameloblast-associated protein precursor", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "pmid": "15234340", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "extracellular region", "id": "GO:0005576" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "pmid": "22387195", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "pmid": "22387195", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099512", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "supramolecular fiber", "id": "GO:0099512" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "extracellular space", "id": "GO:0005615" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "nucleoplasm", "id": "GO:0005654" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "cytosol", "id": "GO:0005829" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071944", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "cell periphery", "id": "GO:0071944" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072686", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "mitotic spindle", "id": "GO:0072686" } ], "total": 9, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009611", "pmid": "25911094", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "response to wounding", "id": "GO:0009611" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042475", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "odontogenesis of dentin-containing tooth", "id": "GO:0042475" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "positive regulation of protein phosphorylation", "id": "GO:0001934" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "inflammatory response", "id": "GO:0006954" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "positive regulation of gene expression", "id": "GO:0010628" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032956", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "regulation of actin cytoskeleton organization", "id": "GO:0032956" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043547", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "positive regulation of GTPase activity", "id": "GO:0043547" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031214", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "biomineral tissue development", "id": "GO:0031214" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060054", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" } ], "name": "positive regulation of epithelial cell proliferation involved in wound healing", "id": "GO:0060054" } ], "total": 9, "name": "Biological Process" } ] }, "site_annotation": [], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000009580", "id": "ENSMUSG00000009580", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/69592", "id": "69592", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR026802", "id": "IPR026802", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69592", "id": "mmu:69592", "database": "KEGG Pathway" }, { "url": "http://www.informatics.jax.org/marker/MGI:1916842", "id": "1916842", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/NHVMPYV/", "id": "NHVMPYV", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1237925at2759", "id": "1237925at2759", "database": "OrthoDB" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16237", "id": "PTHR16237", "database": "PANTHER" }, { "url": "http://pfam.xfam.org/family/PF15424", "id": "PF15424", "database": "Pfam" }, { "url": "http://purl.obolibrary.org/obo/PR_PR_A1E960", "id": "PR_A1E960", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404", "id": "NP_081404", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081404.2", "id": "NP_081404.2", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A1E960", "id": "A1E960", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A1E960-1", "id": "A1E960-1", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [ { "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "site_category": "predicted", "end_pos": 114, "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960#ptm_processing", "id": "A1E960", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 114, "glytoucan_ac": "", "type": "O-linked" }, { "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "site_category": "predicted", "end_pos": 118, "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960#ptm_processing", "id": "A1E960", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 118, "glytoucan_ac": "", "type": "O-linked" }, { "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "site_category": "predicted", "end_pos": 159, "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960#ptm_processing", "id": "A1E960", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 159, "glytoucan_ac": "", "type": "O-linked" }, { "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "site_category": "predicted", "end_pos": 240, "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960#ptm_processing", "id": "A1E960", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 240, "glytoucan_ac": "", "type": "O-linked" }, { "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "site_category": "predicted", "end_pos": 241, "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960#ptm_processing", "id": "A1E960", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 241, "glytoucan_ac": "", "type": "O-linked" }, { "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "site_category": "predicted", "end_pos": 247, "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960#ptm_processing", "id": "A1E960", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 247, "glytoucan_ac": "", "type": "O-linked" }, { "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "site_category": "predicted", "end_pos": 252, "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960#ptm_processing", "id": "A1E960", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 252, "glytoucan_ac": "", "type": "O-linked" }, { "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "site_category": "predicted", "end_pos": 258, "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960#ptm_processing", "id": "A1E960", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 258, "glytoucan_ac": "", "type": "O-linked" }, { "comment": "O-linked (GalNAc...) threonine O-GalNAcylation", "site_category": "predicted", "end_pos": 267, "residue": "Thr", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E960#ptm_processing", "id": "A1E960", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 267, "glytoucan_ac": "", "type": "O-linked" } ], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 29820.0, "chemical_mass": 29820.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1E960", "name": "Odam", "locus": { "end_pos": 87894174, "strand": "+", "start_pos": 87885029, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000009580", "id": "ENSMUSG00000009580", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A1E960#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Apin" }, { "url": "https://www.uniprot.org/uniprot/A1E960#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "Odontogenic ameloblast-associated protein" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1E960", "type": "synonym", "resource": "RefSeq", "name": "odontogenic ameloblast-associated protein precursor" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1E960", "type": "synonym", "resource": "RefSeq", "name": "odontogenic ameloblast-associated protein" } ] }