{
    "uniprot_canonical_ac": "A0JPN0-1", 
    "ptm_annotation": [], 
    "sequence": {
        "header": "tr|A0JPN0-1|A0JPN0_RAT Isoform 1 of RING-type E3 ubiquitin transferase RAD18  OS=Rattus norvegicus OX=10116 GN=Rad18 PE=1 SV=1 CANONICAL=A0JPN0-1", 
        "length": 494, 
        "sequence": "MEDLAEPRWPPGLAMMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEPDLRNNRLLDELVKSMSFARTRLLQFALESPPISPVSSTSKKVVVKVHNVEATQHPVKQGNRLMDKFLIRETGDCVSELLGKENERKFSPQKEISTSADIKETSLLGKTALGLSDANGPVTPSTSTLKLDTKVSCPVCGVSIPENHINKHLDSCLSREEKKESLRSSAHKRKPLPKTVYNLLSDRDLKKKLKQHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIENMEKTRMRLEASKLNENVMVFTKNQTEKEIEEIHSKYRKKHQNEFQLLVDQAKKGYKKTGRMSKAAVMRKDEPAETLPSERMAQEDNVSFSDTVSVTKHFPQSKVDSPGLSEPERPDDSSSCTDILLSSESDSCNSSSSDIIRDLLEEEEAWEAAHKNDQNKEVSPQQNRRTRATERAEIEPRNKRNKN"
    }, 
    "uniprot_id": "A0JPN0_RAT", 
    "glycation": [], 
    "keywords": [], 
    "species": [
        {
            "common_name": "Rat", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                    "id": "A0JPN0", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Rattus norvegicus", 
            "taxid": 10116
        }
    ], 
    "reaction_enzymes": [
        {
            "gene_name": "Rad18", 
            "uniprot_ac": "A0JPN0", 
            "activity": [
                {
                    "evidence": [
                        {
                            "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                            "id": "A0JPN0", 
                            "database": "UniProtKB"
                        }
                    ], 
                    "ec_number": "2.3.2.27", 
                    "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine."
                }, 
                {
                    "evidence": [
                        {
                            "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                            "id": "A0JPN0", 
                            "database": "UniProtKB"
                        }
                    ], 
                    "ec_number": "2.3.2.27", 
                    "activity": ""
                }
            ]
        }, 
        {
            "gene_name": "Pole", 
            "uniprot_ac": "D3Z8X4", 
            "activity": [
                {
                    "evidence": [
                        {
                            "url": "https://www.uniprot.org/uniprot/D3Z8X4", 
                            "id": "D3Z8X4", 
                            "database": "UniProtKB"
                        }
                    ], 
                    "ec_number": "2.7.7.7", 
                    "activity": "Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1)."
                }, 
                {
                    "evidence": [
                        {
                            "url": "https://www.uniprot.org/uniprot/D3Z8X4", 
                            "id": "D3Z8X4", 
                            "database": "UniProtKB"
                        }
                    ], 
                    "ec_number": "2.7.7.7", 
                    "activity": ""
                }
            ]
        }, 
        {
            "gene_name": "Pold1", 
            "uniprot_ac": "O54747", 
            "activity": [
                {
                    "evidence": [
                        {
                            "url": "https://www.uniprot.org/uniprot/O54747", 
                            "id": "O54747", 
                            "database": "UniProtKB"
                        }
                    ], 
                    "ec_number": "2.7.7.7", 
                    "activity": "Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1)."
                }, 
                {
                    "evidence": [
                        {
                            "url": "https://www.uniprot.org/uniprot/O54747", 
                            "id": "O54747", 
                            "database": "UniProtKB"
                        }
                    ], 
                    "ec_number": "2.7.7.7", 
                    "activity": ""
                }, 
                {
                    "evidence": [
                        {
                            "url": "https://www.uniprot.org/uniprot/O54747", 
                            "id": "O54747", 
                            "database": "UniProtKB"
                        }
                    ], 
                    "ec_number": "3.1.11.-", 
                    "activity": ""
                }
            ]
        }, 
        {
            "gene_name": "Ube2b", 
            "uniprot_ac": "P63149", 
            "activity": [
                {
                    "evidence": [
                        {
                            "url": "https://www.uniprot.org/uniprot/P63149", 
                            "id": "P63149", 
                            "database": "UniProtKB"
                        }
                    ], 
                    "ec_number": "2.3.2.23", 
                    "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine."
                }, 
                {
                    "evidence": [
                        {
                            "url": "https://www.uniprot.org/uniprot/P63149", 
                            "id": "P63149", 
                            "database": "UniProtKB"
                        }
                    ], 
                    "ec_number": "2.3.2.23", 
                    "activity": ""
                }
            ]
        }, 
        {
            "gene_name": "Ube2n", 
            "uniprot_ac": "Q9EQX9", 
            "activity": [
                {
                    "evidence": [
                        {
                            "url": "https://www.uniprot.org/uniprot/Q9EQX9", 
                            "id": "Q9EQX9", 
                            "database": "UniProtKB"
                        }
                    ], 
                    "ec_number": "2.3.2.23", 
                    "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine."
                }, 
                {
                    "evidence": [
                        {
                            "url": "https://www.uniprot.org/uniprot/Q9EQX9", 
                            "id": "Q9EQX9", 
                            "database": "UniProtKB"
                        }
                    ], 
                    "ec_number": "2.3.2.23", 
                    "activity": ""
                }
            ]
        }
    ], 
    "publication": [
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/10908344", 
                    "type": "PubMed", 
                    "id": "10908344"
                }
            ], 
            "title": "The human RAD18 gene product interacts with HHR6A and HHR6B.", 
            "journal": "Nucleic acids research", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071141.1", 
                    "id": "NP_001071141.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Xin H, Lin W, Sumanasekera W, Zhang Y, Wu X, Wang Z", 
            "date": "2000"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/11013078", 
                    "type": "PubMed", 
                    "id": "11013078"
                }
            ], 
            "title": "Characterization of mRAD18Sc, a mouse homolog of the yeast postreplication repair gene RAD18.", 
            "journal": "Genomics", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071141.1", 
                    "id": "NP_001071141.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "van der Laan R, Roest HP, Hoogerbrugge JW, Smit EM, Slater R, Baarends WM, Hoeijmakers JH, Grootegoed JA", 
            "date": "2000"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/12509447", 
                    "type": "PubMed", 
                    "id": "12509447"
                }
            ], 
            "title": "Enhanced genomic instability and defective postreplication repair in RAD18 knockout mouse embryonic stem cells.", 
            "journal": "Molecular and cellular biology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071141.1", 
                    "id": "NP_001071141.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Tateishi S, Niwa H, Miyazaki J, Fujimoto S, Inoue H, Yamaizumi M", 
            "date": "2003"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/15383616", 
                    "type": "PubMed", 
                    "id": "15383616"
                }
            ], 
            "title": "Ubiquitin ligase Rad18Sc localizes to the XY body and to other chromosomal regions that are unpaired and transcriptionally silenced during male meiotic prophase.", 
            "journal": "Journal of cell science", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071141.1", 
                    "id": "NP_001071141.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "van der Laan R, Uringa EJ, Wassenaar E, Hoogerbrugge JW, Sleddens E, Odijk H, Roest HP, de Boer P, Hoeijmakers JH, Grootegoed JA, Baarends WM", 
            "date": "2004"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/17970741", 
                    "type": "PubMed", 
                    "id": "17970741"
                }
            ], 
            "title": "A natural antisense transcript against Rad18, specifically expressed in neurons and upregulated during beta-amyloid-induced apoptosis.", 
            "journal": "Eur. J. Neurosci.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                    "id": "A0JPN0", 
                    "database": "UniProtKB"
                }
            ], 
            "authors": "Cavallaro S., Parenti R., Paratore S., Torrisi A.", 
            "date": "2007"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/19068231", 
                    "type": "PubMed", 
                    "id": "19068231"
                }
            ], 
            "title": "Rad18 is required for long-term maintenance of spermatogenesis in mouse testes.", 
            "journal": "Mechanisms of development", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071141.1", 
                    "id": "NP_001071141.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Sun J, Yomogida K, Sakao S, Yamamoto H, Yoshida K, Watanabe K, Morita T, Araki K, Yamamura K, Tateishi S", 
            "date": "2009"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/22036607", 
                    "type": "PubMed", 
                    "id": "22036607"
                }
            ], 
            "title": "RAD18-BRCTx interaction is required for efficient repair of UV-induced DNA damage.", 
            "journal": "DNA repair", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071141.1", 
                    "id": "NP_001071141.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Liu T, Chen H, Kim H, Huen MS, Chen J, Huang J", 
            "date": "2012"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/22673903", 
                    "type": "PubMed", 
                    "id": "22673903"
                }
            ], 
            "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", 
            "journal": "Nat. Commun.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                    "id": "A0JPN0", 
                    "database": "UniProtKB"
                }
            ], 
            "authors": "Olsen J.V., Lage K., Secher A., Dmytriyev A., Lundby A., Lundby C., Nordsborg N.B.", 
            "date": "2012"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/22742833", 
                    "type": "PubMed", 
                    "id": "22742833"
                }
            ], 
            "title": "Tandem protein interaction modules organize the ubiquitin-dependent response to DNA double-strand breaks.", 
            "journal": "Molecular cell", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071141.1", 
                    "id": "NP_001071141.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Panier S, Ichijima Y, Fradet-Turcotte A, Leung CC, Kaustov L, Arrowsmith CH, Durocher D", 
            "date": "2012"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/25023518", 
                    "type": "PubMed", 
                    "id": "25023518"
                }
            ], 
            "title": "DNA damage-specific deubiquitination regulates Rad18 functions to suppress mutagenesis.", 
            "journal": "The Journal of cell biology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071141.1", 
                    "id": "NP_001071141.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Zeman MK, Lin JR, Freire R, Cimprich KA", 
            "date": "2014"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/25931565", 
                    "type": "PubMed", 
                    "id": "25931565"
                }
            ], 
            "title": "DNA repair. Proteomics reveals dynamic assembly of repair complexes during bypass of DNA cross-links.", 
            "journal": "Science (New York, N.Y.)", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071141.1", 
                    "id": "NP_001071141.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Raschle M, Smeenk G, Hansen RK, Temu T, Oka Y, Hein MY, Nagaraj N, Long DT, Walter JC, Hofmann K, Storchova Z, Cox J, Bekker-Jensen S, Mailand N, Mann M", 
            "date": "2015"
        }
    ], 
    "uniprot_ac": "A0JPN0", 
    "gene_names": [
        {
            "url": "https://www.uniprot.org/uniprot/A0JPN0", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "Rad18_predicted"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A0JPN0", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "Rad18"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A0JPN0", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "Rad18"
        }
    ], 
    "reactions": [
        {
            "output_participant_list": [], 
            "evidence": [
                {
                    "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5652005", 
                    "id": "R-RNO-5652005", 
                    "database": "Reactome"
                }
            ], 
            "name": "RAD18:UBE2B or RBX1:CUL4:DDB1:DTL ubiquitin ligase complex binds PCNA:POLD,POLE:RPA:RFC associated with damaged dsDNA", 
            "cellular_location": "plasma membrane", 
            "equation": "", 
            "input_participant_list": [], 
            "enzyme_list": [
                "P63149-1", 
                "D3Z8X4-1", 
                "O54747-1", 
                "A0JPN0-1"
            ], 
            "id": "R-RNO-5652005", 
            "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.<p>The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.<p><a href='/electronic_inference_compara.html' target = 'NEW'>More details and caveats of the event inference in Reactome.</a> For details on PANTHER see also: <a href='http://www.pantherdb.org/about.jsp' target='NEW'>http://www.pantherdb.org/about.jsp</a>"
        }, 
        {
            "output_participant_list": [], 
            "evidence": [
                {
                    "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5652009", 
                    "id": "R-RNO-5652009", 
                    "database": "Reactome"
                }
            ], 
            "name": "RAD18:UBE2B or RBX1:CUL4:DDB1:DTL monoubiquitinates PCNA", 
            "cellular_location": "plasma membrane", 
            "equation": "", 
            "input_participant_list": [], 
            "enzyme_list": [
                "P63149-1", 
                "D3Z8X4-1", 
                "O54747-1", 
                "A0JPN0-1"
            ], 
            "id": "R-RNO-5652009", 
            "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.<p>The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.<p><a href='/electronic_inference_compara.html' target = 'NEW'>More details and caveats of the event inference in Reactome.</a> For details on PANTHER see also: <a href='http://www.pantherdb.org/about.jsp' target='NEW'>http://www.pantherdb.org/about.jsp</a>"
        }, 
        {
            "output_participant_list": [], 
            "evidence": [
                {
                    "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8943003", 
                    "id": "R-RNO-8943003", 
                    "database": "Reactome"
                }
            ], 
            "name": "SHPRH polyubiquitinates monoubiquitinated PCNA", 
            "cellular_location": "plasma membrane", 
            "equation": "", 
            "input_participant_list": [], 
            "enzyme_list": [
                "P63149-1", 
                "Q9EQX9-1", 
                "A0JPN0-1"
            ], 
            "id": "R-RNO-8943003", 
            "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.<p>The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.<p><a href='/electronic_inference_compara.html' target = 'NEW'>More details and caveats of the event inference in Reactome.</a> For details on PANTHER see also: <a href='http://www.pantherdb.org/about.jsp' target='NEW'>http://www.pantherdb.org/about.jsp</a>"
        }, 
        {
            "output_participant_list": [], 
            "evidence": [
                {
                    "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8943007", 
                    "id": "R-RNO-8943007", 
                    "database": "Reactome"
                }
            ], 
            "name": "SHPRH binds monoUb-K164-PCNA, RAD6:RAD18, UBE2V2:Ub:UBE2N", 
            "cellular_location": "plasma membrane", 
            "equation": "", 
            "input_participant_list": [], 
            "enzyme_list": [
                "P63149-1", 
                "Q9EQX9-1", 
                "A0JPN0-1"
            ], 
            "id": "R-RNO-8943007", 
            "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.<p>The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.<p><a href='/electronic_inference_compara.html' target = 'NEW'>More details and caveats of the event inference in Reactome.</a> For details on PANTHER see also: <a href='http://www.pantherdb.org/about.jsp' target='NEW'>http://www.pantherdb.org/about.jsp</a>"
        }, 
        {
            "output_participant_list": [], 
            "evidence": [
                {
                    "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8943040", 
                    "id": "R-RNO-8943040", 
                    "database": "Reactome"
                }
            ], 
            "name": "HLTF polyubiquitinates monoubiquitinated PCNA", 
            "cellular_location": "plasma membrane", 
            "equation": "", 
            "input_participant_list": [], 
            "enzyme_list": [
                "P63149-1", 
                "Q9EQX9-1", 
                "A0JPN0-1"
            ], 
            "id": "R-RNO-8943040", 
            "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.<p>The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.<p><a href='/electronic_inference_compara.html' target = 'NEW'>More details and caveats of the event inference in Reactome.</a> For details on PANTHER see also: <a href='http://www.pantherdb.org/about.jsp' target='NEW'>http://www.pantherdb.org/about.jsp</a>"
        }, 
        {
            "output_participant_list": [], 
            "evidence": [
                {
                    "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8943041", 
                    "id": "R-RNO-8943041", 
                    "database": "Reactome"
                }
            ], 
            "name": "HLTF binds monoUb-K164-PCNA, RAD6:RAD18, UBE2V2:Ub:UBE2N", 
            "cellular_location": "plasma membrane", 
            "equation": "", 
            "input_participant_list": [], 
            "enzyme_list": [
                "P63149-1", 
                "Q9EQX9-1", 
                "A0JPN0-1"
            ], 
            "id": "R-RNO-8943041", 
            "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.<p>The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.<p><a href='/electronic_inference_compara.html' target = 'NEW'>More details and caveats of the event inference in Reactome.</a> For details on PANTHER see also: <a href='http://www.pantherdb.org/about.jsp' target='NEW'>http://www.pantherdb.org/about.jsp</a>"
        }
    ], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A0JPN0#A0JPN0-1", 
            "isoform_ac": "A0JPN0-1", 
            "locus": {
                "end_pos": 144537517, 
                "strand": "+", 
                "start_pos": 144620534, 
                "chromosome": "4", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOT00000066468", 
                        "id": "ENSRNOT00000066468", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOP00000063400", 
                        "id": "ENSRNOP00000063400", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "tr|A0JPN0-1|A0JPN0_RAT Isoform 1 of RING-type E3 ubiquitin transferase RAD18  OS=Rattus norvegicus OX=10116 GN=Rad18 PE=1 SV=1 CANONICAL=A0JPN0-1", 
                "length": 494, 
                "sequence": "MEDLAEPRWPPGLAMMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEPDLRNNRLLDELVKSMSFARTRLLQFALESPPISPVSSTSKKVVVKVHNVEATQHPVKQGNRLMDKFLIRETGDCVSELLGKENERKFSPQKEISTSADIKETSLLGKTALGLSDANGPVTPSTSTLKLDTKVSCPVCGVSIPENHINKHLDSCLSREEKKESLRSSAHKRKPLPKTVYNLLSDRDLKKKLKQHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIENMEKTRMRLEASKLNENVMVFTKNQTEKEIEEIHSKYRKKHQNEFQLLVDQAKKGYKKTGRMSKAAVMRKDEPAETLPSERMAQEDNVSFSDTVSVTKHFPQSKVDSPGLSEPERPDDSSSCTDILLSSESDSCNSSSSDIIRDLLEEEEAWEAAHKNDQNKEVSPQQNRRTRATERAEIEPRNKRNKN"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:362412", 
            "resource": "KEGG Pathway", 
            "id": "rno:362412", 
            "name": ""
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-110314", 
            "description": "Recognition of DNA damage by PCNA-containing replication complex", 
            "resource": "Reactome", 
            "id": "R-RNO-110314", 
            "name": "Recognition of DNA damage by PCNA-containing replication complex"
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8866654", 
            "description": "E3 ubiquitin ligases ubiquitinate target proteins", 
            "resource": "Reactome", 
            "id": "R-RNO-8866654", 
            "name": "E3 ubiquitin ligases ubiquitinate target proteins"
        }
    ], 
    "reaction_participants": [], 
    "function": [], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q9NS91-1", 
            "protein_name": "E3 ubiquitin-protein ligase RAD18", 
            "sequence": {
                "length": 495, 
                "sequence": "MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/48572", 
                    "id": "48572", 
                    "database": "MGI"
                }
            ], 
            "common_name": "Human", 
            "organism": "Homo sapiens", 
            "gene_name": "RAD18", 
            "tax_id": 9606
        }, 
        {
            "uniprot_canonical_ac": "Q9QXK2-1", 
            "protein_name": "E3 ubiquitin-protein ligase RAD18", 
            "sequence": {
                "length": 509, 
                "sequence": "MEVLAEPRWPPGLAVMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEPDLRNNRLLDELVKSMNFARTHLLQFALESPPISPVSSTSKKVVVKVHNADAAQHPVKQANRLMDKFLIRETGDCVFELLGKENERKFSPQKELSTSAEIKETSLLGKPVLGLSDANGPVTPSTSTMKLDTKVSCPVCGVSIPENHINKHLDSCLSREEKKESLRSSAHKRKPLPKTVYNLLSDRDLKKKLKQYGLSVQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIESMEKTRMRLEASKLNENVMVFTKNQTEKEIEEVHSEYRKKHQNAFQLLVDQAKKGYKKTGRVSQAAAMRTDEPAETLPSMRTDEPAETLPSMRTDEPAETLPLMRADEPAETLPSECIAQEDNVSFSDTVSVTNHFPQPQLDSPGPSEPERPDDSSSCTDILFSSDSDSCNRNDQNREVSPQQTRRTRASECVEIEPRNKRNKN"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/48572", 
                    "id": "48572", 
                    "database": "MGI"
                }
            ], 
            "common_name": "Mouse", 
            "organism": "Mus musculus", 
            "gene_name": "Rad18", 
            "tax_id": 10090
        }
    ], 
    "interactions": [], 
    "synthesized_glycans": [], 
    "snv": [], 
    "cluster_types": [
        {
            "name": "homologset.mgi", 
            "label": "MGI Homologs"
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071141.1", 
        "ac": "NP_001071141.1", 
        "name": "E3 ubiquitin-protein ligase RAD18", 
        "summary": ""
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", 
                        "pmid": "21873635", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "ubiquitin protein ligase activity", 
                        "id": "GO:0061630"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031593", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "polyubiquitin modification-dependent protein binding", 
                        "id": "GO:0031593"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "identical protein binding", 
                        "id": "GO:0042802"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "metal ion binding", 
                        "id": "GO:0046872"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "ubiquitin protein ligase binding", 
                        "id": "GO:0031625"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "protein-containing complex binding", 
                        "id": "GO:0044877"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003697", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "single-stranded DNA binding", 
                        "id": "GO:0003697"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000403", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "Y-form DNA binding", 
                        "id": "GO:0000403"
                    }
                ], 
                "total": 8, 
                "name": "Molecular Function"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097505", 
                        "pmid": "21873635", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "Rad6-Rad18 complex", 
                        "id": "GO:0097505"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "nucleus", 
                        "id": "GO:0005634"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "centrosome", 
                        "id": "GO:0005813"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016604", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "nuclear body", 
                        "id": "GO:0016604"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "chromatin", 
                        "id": "GO:0000785"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035861", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "site of double-strand break", 
                        "id": "GO:0035861"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005657", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "replication fork", 
                        "id": "GO:0005657"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042405", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "nuclear inclusion body", 
                        "id": "GO:0042405"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001741", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "XY body", 
                        "id": "GO:0001741"
                    }
                ], 
                "total": 9, 
                "name": "Cellular Component"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006301", 
                        "pmid": "21873635", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "postreplication repair", 
                        "id": "GO:0006301"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006513", 
                        "pmid": "21873635", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "protein monoubiquitination", 
                        "id": "GO:0006513"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051984", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "positive regulation of chromosome segregation", 
                        "id": "GO:0051984"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "spermatogenesis", 
                        "id": "GO:0007283"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cellular response to DNA damage stimulus", 
                        "id": "GO:0006974"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060548", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "negative regulation of cell death", 
                        "id": "GO:0060548"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009411", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "response to UV", 
                        "id": "GO:0009411"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051865", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "protein autoubiquitination", 
                        "id": "GO:0051865"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045910", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A0JPN0", 
                                "id": "A0JPN0", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "negative regulation of DNA recombination", 
                        "id": "GO:0045910"
                    }
                ], 
                "total": 9, 
                "name": "Biological Process"
            }
        ]
    }, 
    "site_annotation": [
        {
            "end_pos": 331, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 329
        }, 
        {
            "end_pos": 394, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 392
        }, 
        {
            "end_pos": 442, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 440
        }
    ], 
    "pro_annotation": [], 
    "crossref": [
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000005907", 
            "id": "ENSRNOG00000005907", 
            "database": "Bgee"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/362412", 
            "id": "362412", 
            "database": "GeneID"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", 
            "id": "IPR001841", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR003034", 
            "id": "IPR003034", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR006642", 
            "id": "IPR006642", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", 
            "id": "IPR013083", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017907", 
            "id": "IPR017907", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036361", 
            "id": "IPR036361", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR039577", 
            "id": "IPR039577", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:362412", 
            "id": "rno:362412", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "https://omabrowser.org/oma/group/NANCDSK/", 
            "id": "NANCDSK", 
            "database": "OMA"
        }, 
        {
            "url": "http://www.orthodb.org/?query=1013108at2759", 
            "id": "1013108at2759", 
            "database": "OrthoDB"
        }, 
        {
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14134", 
            "id": "PTHR14134", 
            "database": "PANTHER"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF02037", 
            "id": "PF02037", 
            "database": "Pfam"
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-110314", 
            "id": "R-RNO-110314", 
            "database": "Reactome"
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-8866654", 
            "id": "R-RNO-8866654", 
            "database": "Reactome"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071141", 
            "id": "NP_001071141", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071141.1", 
            "id": "NP_001071141.1", 
            "database": "RefSeq"
        }, 
        {
            "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1306993", 
            "id": "1306993", 
            "database": "RGD"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A0JPN0", 
            "id": "A0JPN0", 
            "database": "UniProtKB"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A0JPN0-1", 
            "id": "A0JPN0-1", 
            "database": "UniProtKB"
        }
    ], 
    "expression_disease": [], 
    "glycosylation": [], 
    "mutagenesis": [], 
    "disease": [], 
    "phosphorylation": [], 
    "mass": {
        "monoisotopic_mass": 56009.0, 
        "chemical_mass": 56009.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A0JPN0", 
            "name": "Rad18", 
            "locus": {
                "end_pos": 144536729, 
                "strand": "-", 
                "start_pos": 144620731, 
                "chromosome": "4", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSRNOG00000005907", 
                        "id": "ENSRNOG00000005907", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ], 
    "protein_names": [
        {
            "url": "https://www.uniprot.org/uniprot/A0JPN0#names_and_taxonomy", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "2.3.2.27"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A0JPN0", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "E3 ubiquitin-protein ligase RAD18"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A0JPN0", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "RAD18 homolog"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A0JPN0#names_and_taxonomy", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "RING-type E3 ubiquitin transferase RAD18"
        }
    ]
}