{ "uniprot_canonical_ac": "A6H666-1", "ptm_annotation": [], "sequence": { "header": "sp|A6H666-1|COX8C_MOUSE Isoform 1 of Cytochrome c oxidase subunit 8C, mitochondrial OS=Mus musculus OX=10090 GN=Cox8c PE=3 SV=1 CANONICAL=A6H666-1", "length": 72, "sequence": "MSRLLLLCSSLLRHRAVLFSKPGHPGRLSHSESPQKKILSPTESAVGIVVFFTTFYIPAAYVLSSLKYFKGE" }, "uniprot_id": "COX8C_MOUSE", "glycation": [], "keywords": [], "species": [ { "common_name": "Mouse", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A6H666", "id": "A6H666", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "reaction_enzymes": [], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/12762575", "type": "PubMed", "id": "12762575" } ], "title": "Genetic aspects of susceptibility to air pollution.", "journal": "The European respiratory journal. Supplement", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034138.1", "id": "NP_001034138.1", "database": "RefSeq" } ], "authors": "Kleeberger SR", "date": "2003" } ], "uniprot_ac": "A6H666", "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A6H666", "type": "synonym", "resource": "RefSeq", "name": "1700007F21Rik; COX8-; COX8-3; COXV; COXVIII-3" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A6H666", "type": "synonym", "resource": "RefSeq", "name": "Cox8c" }, { "url": "https://www.uniprot.org/uniprot/A6H666", "type": "recommended", "resource": "UniProtKB", "name": "Cox8c" } ], "reactions": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A6H666#A6H666-1", "isoform_ac": "A6H666-1", "locus": { "end_pos": 102899366, "strand": "-", "start_pos": 102900334, "chromosome": "12", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000053611", "id": "ENSMUST00000053611", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000056155", "id": "ENSMUSP00000056155", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A6H666-1|COX8C_MOUSE Isoform 1 of Cytochrome c oxidase subunit 8C, mitochondrial OS=Mus musculus OX=10090 GN=Cox8c PE=3 SV=1 CANONICAL=A6H666-1", "length": 72, "sequence": "MSRLLLLCSSLLRHRAVLFSKPGHPGRLSHSESPQKKILSPTESAVGIVVFFTTFYIPAAYVLSSLKYFKGE" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:75483", "resource": "KEGG Pathway", "id": "mmu:75483", "name": "" } ], "reaction_participants": [], "function": [ { "url": "https://www.uniprot.org/uniprot/A6H666#function", "annotation": "Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A6H666#function", "id": "A6H666", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q7TNN2-1", "protein_name": "Cytochrome c oxidase subunit 8C, mitochondrial", "sequence": { "length": 72, "sequence": "MSRLLQFCSSLLRHRVVLFSKPGHSGRLSHSESPQNQVLTPTESVVGIVVFFATFFIPAAYVMSNLKFFKGE" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A6H666/", "id": "A6H666", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/83496", "id": "83496", "database": "MGI" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "gene_name": "Cox8c", "tax_id": 10116 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034138.1", "ac": "NP_001034138.1", "name": "cytochrome c oxidase subunit 8C, mitochondrial", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004129", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A6H666", "id": "A6H666", "database": "UniProtKB" } ], "name": "cytochrome-c oxidase activity", "id": "GO:0004129" } ], "total": 1, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "pmid": "18614015", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A6H666", "id": "A6H666", "database": "UniProtKB" } ], "name": "mitochondrion", "id": "GO:0005739" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045277", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A6H666", "id": "A6H666", "database": "UniProtKB" } ], "name": "respiratory chain complex IV", "id": "GO:0045277" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A6H666", "id": "A6H666", "database": "UniProtKB" } ], "name": "mitochondrial inner membrane", "id": "GO:0005743" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A6H666", "id": "A6H666", "database": "UniProtKB" } ], "name": "integral component of membrane", "id": "GO:0016021" } ], "total": 4, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006119", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A6H666", "id": "A6H666", "database": "UniProtKB" } ], "name": "oxidative phosphorylation", "id": "GO:0006119" } ], "total": 1, "name": "Biological Process" } ] }, "site_annotation": [], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000043319", "id": "ENSMUSG00000043319", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/75483", "id": "75483", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR003205", "id": "IPR003205", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036548", "id": "IPR036548", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:75483", "id": "mmu:75483", "database": "KEGG Pathway" }, { "url": "http://www.informatics.jax.org/marker/MGI:1922733", "id": "1922733", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/RLAHSEC/", "id": "RLAHSEC", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1624891at2759", "id": "1624891at2759", "database": "OrthoDB" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16717", "id": "PTHR16717", "database": "PANTHER" }, { "url": "http://pfam.xfam.org/family/PF02285", "id": "PF02285", "database": "Pfam" }, { "url": "http://purl.obolibrary.org/obo/PR_PR_A6H666", "id": "PR_A6H666", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034138", "id": "NP_001034138", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034138.1", "id": "NP_001034138.1", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A6H666", "id": "A6H666", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A6H666-1", "id": "A6H666-1", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 8009.0, "chemical_mass": 8009.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A6H666", "name": "Cox8c", "locus": { "end_pos": 102900526, "strand": "+", "start_pos": 102899316, "chromosome": "12", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000043319", "id": "ENSMUSG00000043319", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A6H666", "type": "synonym", "resource": "RefSeq", "name": "COX VIII-3; cytochrome c oxidase subunit 8-3; cytochrome c oxidase polypeptide 8; cytochrome c oxidase subunit VIIIc; cytochrome c oxidase polypeptide VIII" }, { "url": "https://www.uniprot.org/uniprot/A6H666#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "COX VIII-3" }, { "url": "https://www.uniprot.org/uniprot/A6H666#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Cytochrome c oxidase polypeptide 8 isoform 3" }, { "url": "https://www.uniprot.org/uniprot/A6H666#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Cytochrome c oxidase polypeptide VIII isoform 3" }, { "url": "https://www.uniprot.org/uniprot/A6H666#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Cytochrome c oxidase subunit 8-3" }, { "url": "https://www.uniprot.org/uniprot/A6H666#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "Cytochrome c oxidase subunit 8C, mitochondrial" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A6H666", "type": "synonym", "resource": "RefSeq", "name": "cytochrome c oxidase subunit 8C, mitochondrial" } ] }