{ "uniprot_canonical_ac": "A4UUI3-1", "ptm_annotation": [], "sequence": { "header": "tr|A4UUI3-1|A4UUI3_MOUSE Isoform 1 of Guanylate-binding protein 4 OS=Mus musculus OX=10090 GN=Gbp4 PE=1 SV=1 CANONICAL=A4UUI3-1", "length": 631, "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGWSHTGKSYLMNCLAGQNHVSGTLPTSQRFPSGLHRAVSDQGHLDVVHAPPHQARALVLLDTEGLGDVEKGDPKNDLWIFALSVLLSSTFVYNSMNTINHQALEQLHYVTELTELIRAKSSPNPHGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDEYLENALKLIPGNNPRIQASNSARECIRRFFPNRKCFVFEWPTHDIELIKQLETISEDQLDPTFKESAMAFASYIFTYAKIKTLREGIKVTGNGLGTLVTTYVDAINSGAVPCLDDAVTTLAQRENSVAVQKAASHYSEQMAQRLSLPTDTIQELLDVHAACEKEAMAVFMEHSFKDENQQFLKKLVELLREKNGLFLLKNEEASDKYCQEELDRLSKDLMDNISTFSVPGGHRLYMDMREKIEHDYWQVPRKGVKASEVFQNFLQSQAIIESSILQADTALTAGQKAIAEKHTKKEAAEKEQDLLRQKQKEHQEYMEAQEKRNKENLEQLRRKLEQEREQLIKDHNMMLEKLTKEQKTFREEGYKTQAEELRREIHQLGHNIKEMKQNGDSLVESILRSWFSFISPPSESEKAISSVLSLLRKKDRL" }, "uniprot_id": "A0A0G2JEJ5_MOUSE", "glycation": [], "keywords": [], "species": [ { "common_name": "Mouse", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "reaction_enzymes": [ { "gene_name": "Eif5b", "uniprot_ac": "B2GUV7", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/B2GUV7", "id": "B2GUV7", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/B2GUV7", "id": "B2GUV7", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "" } ] }, { "gene_name": "Eif2s3y", "uniprot_ac": "C9WPN6", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/C9WPN6", "id": "C9WPN6", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/C9WPN6", "id": "C9WPN6", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "" } ] }, { "gene_name": "Rras", "uniprot_ac": "D3Z8L7", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/D3Z8L7", "id": "D3Z8L7", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Guf1", "uniprot_ac": "D3ZHF8", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/D3ZHF8", "id": "D3ZHF8", "database": "UniProtKB" } ], "ec_number": "3.6.5.n1", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/D3ZHF8", "id": "D3ZHF8", "database": "UniProtKB" } ], "ec_number": "3.6.5.n1", "activity": "" } ] }, { "gene_name": "Tppp", "uniprot_ac": "D3ZQL7", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/D3ZQL7", "id": "D3ZQL7", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Rab5a", "uniprot_ac": "M0RC99", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/M0RC99", "id": "M0RC99", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/M0RC99", "id": "M0RC99", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RAB27B", "uniprot_ac": "O00194", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O00194", "id": "O00194", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O00194", "id": "O00194", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "DNM1L", "uniprot_ac": "O00429", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O00429", "id": "O00429", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O00429", "id": "O00429", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "Mras", "uniprot_ac": "O08989", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O08989", "id": "O08989", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O08989", "id": "O08989", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "MRAS", "uniprot_ac": "O14807", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O14807", "id": "O14807", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O14807", "id": "O14807", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Dnm1l", "uniprot_ac": "O35303", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O35303", "id": "O35303", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O35303", "id": "O35303", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "OPA1", "uniprot_ac": "O60313", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O60313", "id": "O60313", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O60313", "id": "O60313", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "EIF5B", "uniprot_ac": "O60841", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O60841", "id": "O60841", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O60841", "id": "O60841", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "" } ] }, { "gene_name": "TPPP", "uniprot_ac": "O94811", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O94811", "id": "O94811", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "MFN2", "uniprot_ac": "O95140", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O95140", "id": "O95140", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "NRAS", "uniprot_ac": "P01111", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P01111", "id": "P01111", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P01111", "id": "P01111", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "HRAS", "uniprot_ac": "P01112", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P01112", "id": "P01112", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P01112", "id": "P01112", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "KRAS", "uniprot_ac": "P01116", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P01116", "id": "P01116", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P01116", "id": "P01116", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Nras", "uniprot_ac": "P08556", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P08556", "id": "P08556", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P08556", "id": "P08556", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Kras", "uniprot_ac": "P08644", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P08644", "id": "P08644", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P08644", "id": "P08644", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RAP2A", "uniprot_ac": "P10114", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P10114", "id": "P10114", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P10114", "id": "P10114", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RRAS", "uniprot_ac": "P10301", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P10301", "id": "P10301", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Rras", "uniprot_ac": "P10833", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P10833", "id": "P10833", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "RALA", "uniprot_ac": "P11233", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P11233", "id": "P11233", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P11233", "id": "P11233", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RALB", "uniprot_ac": "P11234", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P11234", "id": "P11234", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P11234", "id": "P11234", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Srp54", "uniprot_ac": "P14576", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P14576", "id": "P14576", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Hras", "uniprot_ac": "P20171", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P20171", "id": "P20171", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P20171", "id": "P20171", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RAB5A", "uniprot_ac": "P20339", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P20339", "id": "P20339", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P20339", "id": "P20339", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Dnm1", "uniprot_ac": "P21575", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P21575", "id": "P21575", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P21575", "id": "P21575", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "Rab27a", "uniprot_ac": "P23640", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P23640", "id": "P23640", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P23640", "id": "P23640", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Drg1", "uniprot_ac": "P32233", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P32233", "id": "P32233", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "GBP1", "uniprot_ac": "P32455", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P32455", "id": "P32455", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "GBP2", "uniprot_ac": "P32456", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P32456", "id": "P32456", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Kras", "uniprot_ac": "P32883", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P32883", "id": "P32883", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P32883", "id": "P32883", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rab10", "uniprot_ac": "P35281", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P35281", "id": "P35281", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P35281", "id": "P35281", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Ralb", "uniprot_ac": "P36860", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P36860", "id": "P36860", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P36860", "id": "P36860", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Dnm2", "uniprot_ac": "P39052", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P39052", "id": "P39052", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P39052", "id": "P39052", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "Dnm1", "uniprot_ac": "P39053", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P39053", "id": "P39053", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P39053", "id": "P39053", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "Dnm2", "uniprot_ac": "P39054", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P39054", "id": "P39054", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P39054", "id": "P39054", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "EIF2S3", "uniprot_ac": "P41091", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P41091", "id": "P41091", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P41091", "id": "P41091", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "" } ] }, { "gene_name": "DNM2", "uniprot_ac": "P50570", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P50570", "id": "P50570", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P50570", "id": "P50570", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "RAB27A", "uniprot_ac": "P51159", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P51159", "id": "P51159", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P51159", "id": "P51159", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "DRG2", "uniprot_ac": "P55039", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P55039", "id": "P55039", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Opa1", "uniprot_ac": "P58281", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P58281", "id": "P58281", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P58281", "id": "P58281", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "RAC3", "uniprot_ac": "P60763", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P60763", "id": "P60763", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P60763", "id": "P60763", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rac3", "uniprot_ac": "P60764", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P60764", "id": "P60764", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P60764", "id": "P60764", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Cdc42", "uniprot_ac": "P60766", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P60766", "id": "P60766", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P60766", "id": "P60766", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "CDC42", "uniprot_ac": "P60953", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P60953", "id": "P60953", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P60953", "id": "P60953", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "SRP54", "uniprot_ac": "P61011", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61011", "id": "P61011", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "RAB10", "uniprot_ac": "P61026", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61026", "id": "P61026", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61026", "id": "P61026", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rab10", "uniprot_ac": "P61027", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61027", "id": "P61027", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61027", "id": "P61027", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RAP1B", "uniprot_ac": "P61224", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61224", "id": "P61224", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61224", "id": "P61224", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RAP2B", "uniprot_ac": "P61225", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61225", "id": "P61225", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61225", "id": "P61225", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rap2b", "uniprot_ac": "P61226", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61226", "id": "P61226", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61226", "id": "P61226", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rap2b", "uniprot_ac": "P61227", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61227", "id": "P61227", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61227", "id": "P61227", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RHOA", "uniprot_ac": "P61586", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61586", "id": "P61586", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61586", "id": "P61586", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rhoa", "uniprot_ac": "P61589", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61589", "id": "P61589", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P61589", "id": "P61589", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RRAS2", "uniprot_ac": "P62070", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P62070", "id": "P62070", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Rras2", "uniprot_ac": "P62071", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P62071", "id": "P62071", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "RAP1A", "uniprot_ac": "P62834", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P62834", "id": "P62834", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P62834", "id": "P62834", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rap1a", "uniprot_ac": "P62835", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P62835", "id": "P62835", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P62835", "id": "P62835", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rap1a", "uniprot_ac": "P62836", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P62836", "id": "P62836", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P62836", "id": "P62836", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RAC1", "uniprot_ac": "P63000", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P63000", "id": "P63000", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P63000", "id": "P63000", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rac1", "uniprot_ac": "P63001", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P63001", "id": "P63001", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P63001", "id": "P63001", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rala", "uniprot_ac": "P63321", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P63321", "id": "P63321", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P63321", "id": "P63321", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rala", "uniprot_ac": "P63322", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P63322", "id": "P63322", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P63322", "id": "P63322", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rit2", "uniprot_ac": "P70425", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P70425", "id": "P70425", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P70425", "id": "P70425", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rit1", "uniprot_ac": "P70426", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P70426", "id": "P70426", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P70426", "id": "P70426", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Eif2s3", "uniprot_ac": "P81795", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P81795", "id": "P81795", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P81795", "id": "P81795", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "" } ] }, { "gene_name": "Mras", "uniprot_ac": "P97538", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P97538", "id": "P97538", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P97538", "id": "P97538", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Gbp1", "uniprot_ac": "Q01514", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q01514", "id": "Q01514", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Nras", "uniprot_ac": "Q04970", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q04970", "id": "Q04970", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q04970", "id": "Q04970", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "DNM1", "uniprot_ac": "Q05193", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q05193", "id": "Q05193", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q05193", "id": "Q05193", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "Eif5b", "uniprot_ac": "Q05D44", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q05D44", "id": "Q05D44", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q05D44", "id": "Q05D44", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "" } ] }, { "gene_name": "Dnm3", "uniprot_ac": "Q08877", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q08877", "id": "Q08877", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q08877", "id": "Q08877", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "Rasl12", "uniprot_ac": "Q08AT1", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q08AT1", "id": "Q08AT1", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q08AT1", "id": "Q08AT1", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Opa1", "uniprot_ac": "Q2TA68", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q2TA68", "id": "Q2TA68", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q2TA68", "id": "Q2TA68", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "EIF2S3B", "uniprot_ac": "Q2VIR3", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q2VIR3", "id": "Q2VIR3", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q2VIR3", "id": "Q2VIR3", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "" } ] }, { "gene_name": "Tgtp2", "uniprot_ac": "Q3T9E4", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q3T9E4", "id": "Q3T9E4", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Rit2", "uniprot_ac": "Q5BJQ5", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q5BJQ5", "id": "Q5BJQ5", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q5BJQ5", "id": "Q5BJQ5", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Lrrk2", "uniprot_ac": "Q5S006", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q5S006", "id": "Q5S006", "database": "UniProtKB" } ], "ec_number": "2.7.11.1", "activity": "ATP + a protein = ADP + a phosphoprotein." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q5S006", "id": "Q5S006", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q5S006", "id": "Q5S006", "database": "UniProtKB" } ], "ec_number": "2.7.11.1", "activity": "" } ] }, { "gene_name": "LRRK2", "uniprot_ac": "Q5S007", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q5S007", "id": "Q5S007", "database": "UniProtKB" } ], "ec_number": "2.7.11.1", "activity": "ATP + a protein = ADP + a phosphoprotein." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q5S007", "id": "Q5S007", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q5S007", "id": "Q5S007", "database": "UniProtKB" } ], "ec_number": "2.7.11.1", "activity": "" } ] }, { "gene_name": "Rasl10b", "uniprot_ac": "Q5SSG5", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q5SSG5", "id": "Q5SSG5", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q5SSG5", "id": "Q5SSG5", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RRAGB", "uniprot_ac": "Q5VZM2", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q5VZM2", "id": "Q5VZM2", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Gbp4", "uniprot_ac": "Q61107", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q61107", "id": "Q61107", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Hras", "uniprot_ac": "Q61411", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q61411", "id": "Q61411", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q61411", "id": "Q61411", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Tgtp1", "uniprot_ac": "Q62293", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q62293", "id": "Q62293", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Rap1b", "uniprot_ac": "Q62636", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q62636", "id": "Q62636", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q62636", "id": "Q62636", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rraga", "uniprot_ac": "Q63486", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q63486", "id": "Q63486", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "RragB", "uniprot_ac": "Q63487", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q63487", "id": "Q63487", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Gbp2", "uniprot_ac": "Q63663", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q63663", "id": "Q63663", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Srp54", "uniprot_ac": "Q6AYB5", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6AYB5", "id": "Q6AYB5", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Irgc", "uniprot_ac": "Q6AYF9", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6AYF9", "id": "Q6AYF9", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Rasl11a", "uniprot_ac": "Q6IMA3", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6IMA3", "id": "Q6IMA3", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6IMA3", "id": "Q6IMA3", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rasl11b", "uniprot_ac": "Q6IMA7", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6IMA7", "id": "Q6IMA7", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6IMA7", "id": "Q6IMA7", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rasl11a", "uniprot_ac": "Q6IMB1", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6IMB1", "id": "Q6IMB1", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6IMB1", "id": "Q6IMB1", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rragb", "uniprot_ac": "Q6NTA4", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6NTA4", "id": "Q6NTA4", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "IRGC", "uniprot_ac": "Q6NXR0", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6NXR0", "id": "Q6NXR0", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Rac1", "uniprot_ac": "Q6RUV5", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6RUV5", "id": "Q6RUV5", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6RUV5", "id": "Q6RUV5", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RASL11A", "uniprot_ac": "Q6T310", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6T310", "id": "Q6T310", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6T310", "id": "Q6T310", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RRAGA", "uniprot_ac": "Q7L523", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q7L523", "id": "Q7L523", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Eras", "uniprot_ac": "Q7TN89", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q7TN89", "id": "Q7TN89", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q7TN89", "id": "Q7TN89", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Tppp", "uniprot_ac": "Q7TQD2", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q7TQD2", "id": "Q7TQD2", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Rragd", "uniprot_ac": "Q7TT45", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q7TT45", "id": "Q7TT45", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "ERAS", "uniprot_ac": "Q7Z444", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q7Z444", "id": "Q7Z444", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q7Z444", "id": "Q7Z444", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Mfn2", "uniprot_ac": "Q80U63", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q80U63", "id": "Q80U63", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Rraga", "uniprot_ac": "Q80X95", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q80X95", "id": "Q80X95", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Rap2a", "uniprot_ac": "Q80ZJ1", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q80ZJ1", "id": "Q80ZJ1", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q80ZJ1", "id": "Q80ZJ1", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Mfn1", "uniprot_ac": "Q811U4", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q811U4", "id": "Q811U4", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Rap2c", "uniprot_ac": "Q8BU31", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8BU31", "id": "Q8BU31", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8BU31", "id": "Q8BU31", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Dnm3", "uniprot_ac": "Q8BZ98", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8BZ98", "id": "Q8BZ98", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8BZ98", "id": "Q8BZ98", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "Irgc", "uniprot_ac": "Q8C262", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8C262", "id": "Q8C262", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Guf1", "uniprot_ac": "Q8C3X4", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8C3X4", "id": "Q8C3X4", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Mmaa", "uniprot_ac": "Q8C7H1", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8C7H1", "id": "Q8C7H1", "database": "UniProtKB" } ], "ec_number": "3.6.-.-", "activity": "" } ] }, { "gene_name": "Gbp5", "uniprot_ac": "Q8CFB4", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8CFB4", "id": "Q8CFB4", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Cdc42", "uniprot_ac": "Q8CFN2", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8CFN2", "id": "Q8CFN2", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8CFN2", "id": "Q8CFN2", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "MMAA", "uniprot_ac": "Q8IVH4", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8IVH4", "id": "Q8IVH4", "database": "UniProtKB" } ], "ec_number": "3.6.-.-", "activity": "" } ] }, { "gene_name": "MFN1", "uniprot_ac": "Q8IWA4", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8IWA4", "id": "Q8IWA4", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Dnm1l", "uniprot_ac": "Q8K1M6", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8K1M6", "id": "Q8K1M6", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8K1M6", "id": "Q8K1M6", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "Rasl10a", "uniprot_ac": "Q8K5A4", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8K5A4", "id": "Q8K5A4", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8K5A4", "id": "Q8K5A4", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "GUF1", "uniprot_ac": "Q8N442", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8N442", "id": "Q8N442", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Rerg", "uniprot_ac": "Q8R367", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8R367", "id": "Q8R367", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8R367", "id": "Q8R367", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Mfn1", "uniprot_ac": "Q8R4Z9", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8R4Z9", "id": "Q8R4Z9", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Mfn2", "uniprot_ac": "Q8R500", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8R500", "id": "Q8R500", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Rasl11b", "uniprot_ac": "Q922H7", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q922H7", "id": "Q922H7", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q922H7", "id": "Q922H7", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RASL10A", "uniprot_ac": "Q92737", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q92737", "id": "Q92737", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q92737", "id": "Q92737", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RIT1", "uniprot_ac": "Q92963", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q92963", "id": "Q92963", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q92963", "id": "Q92963", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RERG", "uniprot_ac": "Q96A58", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q96A58", "id": "Q96A58", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q96A58", "id": "Q96A58", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "GBP5", "uniprot_ac": "Q96PP8", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q96PP8", "id": "Q96PP8", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "GBP4", "uniprot_ac": "Q96PP9", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q96PP9", "id": "Q96PP9", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "RASL10B", "uniprot_ac": "Q96S79", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q96S79", "id": "Q96S79", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q96S79", "id": "Q96S79", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RIT2", "uniprot_ac": "Q99578", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99578", "id": "Q99578", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99578", "id": "Q99578", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rap1b", "uniprot_ac": "Q99JI6", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99JI6", "id": "Q99JI6", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99JI6", "id": "Q99JI6", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rragc", "uniprot_ac": "Q99K70", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99K70", "id": "Q99K70", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Rab27b", "uniprot_ac": "Q99P58", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99P58", "id": "Q99P58", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99P58", "id": "Q99P58", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rab27b", "uniprot_ac": "Q99P74", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99P74", "id": "Q99P74", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99P74", "id": "Q99P74", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RASL11B", "uniprot_ac": "Q9BPW5", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9BPW5", "id": "Q9BPW5", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9BPW5", "id": "Q9BPW5", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rab5a", "uniprot_ac": "Q9CQD1", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9CQD1", "id": "Q9CQD1", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9CQD1", "id": "Q9CQD1", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rab27a", "uniprot_ac": "Q9ERI2", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9ERI2", "id": "Q9ERI2", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9ERI2", "id": "Q9ERI2", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "GBP3", "uniprot_ac": "Q9H0R5", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9H0R5", "id": "Q9H0R5", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "RERGL", "uniprot_ac": "Q9H628", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9H628", "id": "Q9H628", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9H628", "id": "Q9H628", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RRAGC", "uniprot_ac": "Q9HB90", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9HB90", "id": "Q9HB90", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Ralb", "uniprot_ac": "Q9JIW9", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9JIW9", "id": "Q9JIW9", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9JIW9", "id": "Q9JIW9", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "RRAGD", "uniprot_ac": "Q9NQL2", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9NQL2", "id": "Q9NQL2", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "RASL12", "uniprot_ac": "Q9NYN1", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9NYN1", "id": "Q9NYN1", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9NYN1", "id": "Q9NYN1", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Rhoa", "uniprot_ac": "Q9QUI0", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9QUI0", "id": "Q9QUI0", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9QUI0", "id": "Q9QUI0", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Drg2", "uniprot_ac": "Q9QXB9", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9QXB9", "id": "Q9QXB9", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Iigp1", "uniprot_ac": "Q9QZ85", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9QZ85", "id": "Q9QZ85", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "DNM3", "uniprot_ac": "Q9UQ16", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9UQ16", "id": "Q9UQ16", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9UQ16", "id": "Q9UQ16", "database": "UniProtKB" } ], "ec_number": "3.6.5.5", "activity": "" } ] }, { "gene_name": "DRG1", "uniprot_ac": "Q9Y295", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Y295", "id": "Q9Y295", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "RAP2C", "uniprot_ac": "Q9Y3L5", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Y3L5", "id": "Q9Y3L5", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Y3L5", "id": "Q9Y3L5", "database": "UniProtKB" } ], "ec_number": "3.6.5.2", "activity": "" } ] }, { "gene_name": "Gbp2", "uniprot_ac": "Q9Z0E6", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Z0E6", "id": "Q9Z0E6", "database": "UniProtKB" } ], "ec_number": "3.6.5.-", "activity": "" } ] }, { "gene_name": "Eif2s3x", "uniprot_ac": "Q9Z0N1", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Z0N1", "id": "Q9Z0N1", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Z0N1", "id": "Q9Z0N1", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "" } ] }, { "gene_name": "Eif2s3y", "uniprot_ac": "Q9Z0N2", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Z0N2", "id": "Q9Z0N2", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "GTP + H(2)O = GDP + phosphate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Z0N2", "id": "Q9Z0N2", "database": "UniProtKB" } ], "ec_number": "3.6.5.3", "activity": "" } ] } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/12396730", "type": "PubMed", "id": "12396730" } ], "title": "Murine GBP-5, a new member of the murine guanylate-binding protein family, is coordinately regulated with other GBPs in vivo and in vitro.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934.1", "id": "NP_001242934.1", "database": "RefSeq" } ], "authors": "Nguyen TT, Hu Y, Widney DP, Mar RA, Smith JB", "date": "2002" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/16689661", "type": "PubMed", "id": "16689661" } ], "title": "In silico genomic analysis of the human and murine guanylate-binding protein (GBP) gene clusters.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934.1", "id": "NP_001242934.1", "database": "RefSeq" } ], "authors": "Olszewski MA, Gray J, Vestal DJ", "date": "2006" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/17919070", "type": "PubMed", "id": "17919070" } ], "title": "In silico and in vitro characterization of mGBP4 splice variants.", "journal": "DNA and cell biology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934.1", "id": "NP_001242934.1", "database": "RefSeq" } ], "authors": "Konermann C, Kresse A, Beuter-Gunia C, Wurthner J, Degrandi D, Pfeffer K, Beer S", "date": "2007" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/18025219", "type": "PubMed", "id": "18025219" } ], "title": "Extensive characterization of IFN-induced GTPases mGBP1 to mGBP10 involved in host defense.", "journal": "J. Immunol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4UUI4", "id": "A4UUI4", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934.1", "id": "NP_001242934.1", "database": "RefSeq" } ], "authors": "Pfeffer K., Beer S., Konermann C., Beuter-Gunia C., Degrandi D., Wurthner J., Kresse A., Kurig S.", "date": "2007" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21551061", "type": "PubMed", "id": "21551061" } ], "title": "A family of IFN-gamma-inducible 65-kD GTPases protects against bacterial infection.", "journal": "Science (New York, N.Y.)", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934.1", "id": "NP_001242934.1", "database": "RefSeq" } ], "authors": "Kim BH, Shenoy AR, Kumar P, Das R, Tiwari S, MacMicking JD", "date": "2011" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/22095711", "type": "PubMed", "id": "22095711" } ], "title": "Guanylate binding protein 4 negatively regulates virus-induced type I IFN and antiviral response by targeting IFN regulatory factor 7.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934.1", "id": "NP_001242934.1", "database": "RefSeq" } ], "authors": "Hu Y, Wang J, Yang B, Zheng N, Qin M, Ji Y, Lin G, Tian L, Wu X, Wu L, Sun B", "date": "2011" } ], "uniprot_ac": "A4UUI3", "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A4UUI3", "type": "synonym", "resource": "RefSeq", "name": "AW228052; Mag-; Mag-2; Mp; Mpa; Mpa-2; Mpa2" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A4UUI3", "type": "synonym", "resource": "RefSeq", "name": "Gbp4" }, { "url": "https://www.uniprot.org/uniprot/A4UUI3", "type": "recommended", "resource": "UniProtKB", "name": "Gbp4" } ], "reactions": [ { "output_participant_list": [], "evidence": [ { "url": "https://www.rhea-db.org/rhea/19669", "id": "19669", "database": "Rhea" } ], "name": "", "cellular_location": "plasma membrane", "equation": "GTP + H2O = GDP + H(+) + phosphate", "input_participant_list": [], "enzyme_list": [ "Q6RUV5-1", "Q8CFN2-1", "Q99P74-1", "P61227-1", "P97538-1", "Q04970-1", "Q63486-1", "Q63487-1", "P20171-1", "P39052-1", "Q8R4Z9-1", "Q63663-1", "C9WPN6-1", "Q8R500-1", "P21575-1", "B2GUV7-1", "Q08877-1", "Q2TA68-1", "O35303-1", "Q6AYF9-1", "P23640-1", "M0RC99-1", "D3ZQL7-1", "P61589-1", "P36860-1", "P62836-1", "P63322-1", "Q5BJQ5-1", "Q6AYB5-1", "Q6IMA3-1", "Q6IMA7-1", "D3ZHF8-1", "D3Z8L7-1", "P08644-1", "P35281-1", "Q62636-1", "P81795-1", "O00429-1", "O60841-1", "O60313-1", "P11234-1", "P11233-1", "Q8IWA4-1", "P10114-1", "P01112-1", "P61225-1", "Q5VZM2-1", "Q96S79-1", "Q05193-1", "P62834-1", "P41091-1", "Q2VIR3-1", "P60763-1", "Q9H628-1", "Q6T310-1", "P51159-1", "Q9UQ16-1", "Q9H0R5-1", "O95140-1", "P50570-1", "Q96PP8-1", "Q96PP9-1", "P32455-1", "Q8N442-1", "Q6NXR0-1", "P20339-1", "P63000-1", "P55039-1", "Q9Y295-1", "P32456-1", "P60953-2", "P61586-1", "Q5S007-1", "O00194-1", "O94811-1", "Q7Z444-1", "Q9NYN1-1", "Q92737-1", "Q8IVH4-1", "P61026-1", "P01111-1", "P01116-1", "P61224-1", "Q96A58-1", "Q92963-1", "Q99578-1", "Q9NQL2-1", "P10301-1", "P62070-1", "Q7L523-1", "Q9HB90-1", "Q9BPW5-1", "O14807-1", "Q9Y3L5-1", "P61011-1", "P39053-1", "P39054-1", "Q8BZ98-1", "Q05D44-1", "Q80U63-1", "P61226-1", "Q9JIW9-1", "Q61411-1", "Q8R367-1", "Q5SSG5-1", "P63001-1", "Q9ERI2-1", "Q01514-1", "Q811U4-1", "Q61107-1", "Q8K1M6-1", "Q8CFB4-1", "Q9Z0E6-1", "Q9QZ85-1", "P58281-1", "O08989-1", "Q62293-1", "P32233-1", "Q9QXB9-1", "Q8C3X4-1", "Q8C262-1", "Q5S006-1", "Q3T9E4-1", "P60766-2", "Q9QUI0-1", "Q7TQD2-1", "Q9CQD1-1", "Q99P58-1", "P61027-1", "Q08AT1-1", "Q8BU31-1", "Q99JI6-1", "P10833-1", "Q80ZJ1-1", "P70425-1", "P62071-1", "Q6NTA4-1", "Q80X95-1", "Q922H7-1", "Q8K5A4-1", "P14576-1", "Q9Z0N2-1", "Q9Z0N1-1", "Q8C7H1-1", "Q99K70-1", "P08556-1", "P60764-1", "P62835-1", "Q7TN89-1", "P63321-1", "Q6IMB1-1", "Q7TT45-1", "P70426-1", "P32883-1" ], "id": "19669", "summary": "" } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3#A0A0G2JDT5-1", "isoform_ac": "A0A0G2JDT5-1", "locus": { "end_pos": 105125226, "strand": "+", "start_pos": 105137021, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000197799", "id": "ENSMUST00000197799", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000142493", "id": "ENSMUSP00000142493", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A0G2JDT5-1|A0A0G2JDT5_MOUSE Computationally mapped isoform of Guanylate-binding protein 4 OS=Mus musculus OX=10090 GN=Gbp4 PE=3 SV=1 CANONICAL=A4UUI3-1", "length": 184, "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGWSHTGKSYLMNCLAGQNHVSGTLPTSQRFPSGLHRAVSDQGHLDVVHAPPHQARALVLLDTEGLGDVEKGDPKNDLWIFALSVLLSSTFVYNSMNTINHQALEQLHYVTELTELIRAKSSPNPHGIKNSTEFVSFFPDFVW" } }, { "url": "https://www.uniprot.org/uniprot/A4UUI3#A0A0G2JEJ5-1", "isoform_ac": "A0A0G2JEJ5-1", "locus": { "end_pos": 105122909, "strand": "+", "start_pos": 105125554, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000196677", "id": "ENSMUST00000196677", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000142795", "id": "ENSMUSP00000142795", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A0G2JEJ5-1|A0A0G2JEJ5_MOUSE Computationally mapped isoform of Guanylate-binding protein 4 OS=Mus musculus OX=10090 GN=Gbp4 PE=1 SV=1 CANONICAL=A4UUI3-1", "length": 149, "sequence": "MNTINHQALEQLHYVTELTELIRAKSSPNPHGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDEYLENALKLIPGNNPRIQASNSARECIRRFFPNRKCFVFEWPTHDIELIKQLETISEDQLDPTFKESAMAFASYIFTYAKIK" } }, { "url": "https://www.uniprot.org/uniprot/A4UUI3#A0A0G2JGT4-1", "isoform_ac": "A0A0G2JGT4-1", "locus": { "end_pos": 105122975, "strand": "+", "start_pos": 105125554, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000199629", "id": "ENSMUST00000199629", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000143689", "id": "ENSMUSP00000143689", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A0G2JGT4-1|A0A0G2JGT4_MOUSE Computationally mapped isoform of Guanylate-binding protein 4 OS=Mus musculus OX=10090 GN=Gbp4 PE=1 SV=1 CANONICAL=A4UUI3-1", "length": 127, "sequence": "MNTINHQALEQLHYVTELTELIRAKSSPNPHGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDEYLENALKLIPGNNPRIQASNSARECIRRFFPNRKCFVFEWPTHDIELIKQLETISEDQL" } }, { "url": "https://www.uniprot.org/uniprot/A4UUI3#A4UUI3-1", "isoform_ac": "A4UUI3-1", "locus": { "end_pos": 105118281, "strand": "+", "start_pos": 105137021, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000100962", "id": "ENSMUST00000100962", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000098522", "id": "ENSMUSP00000098522", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A4UUI3-1|A4UUI3_MOUSE Isoform 1 of Guanylate-binding protein 4 OS=Mus musculus OX=10090 GN=Gbp4 PE=1 SV=1 CANONICAL=A4UUI3-1", "length": 631, "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGWSHTGKSYLMNCLAGQNHVSGTLPTSQRFPSGLHRAVSDQGHLDVVHAPPHQARALVLLDTEGLGDVEKGDPKNDLWIFALSVLLSSTFVYNSMNTINHQALEQLHYVTELTELIRAKSSPNPHGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDEYLENALKLIPGNNPRIQASNSARECIRRFFPNRKCFVFEWPTHDIELIKQLETISEDQLDPTFKESAMAFASYIFTYAKIKTLREGIKVTGNGLGTLVTTYVDAINSGAVPCLDDAVTTLAQRENSVAVQKAASHYSEQMAQRLSLPTDTIQELLDVHAACEKEAMAVFMEHSFKDENQQFLKKLVELLREKNGLFLLKNEEASDKYCQEELDRLSKDLMDNISTFSVPGGHRLYMDMREKIEHDYWQVPRKGVKASEVFQNFLQSQAIIESSILQADTALTAGQKAIAEKHTKKEAAEKEQDLLRQKQKEHQEYMEAQEKRNKENLEQLRRKLEQEREQLIKDHNMMLEKLTKEQKTFREEGYKTQAEELRREIHQLGHNIKEMKQNGDSLVESILRSWFSFISPPSESEKAISSVLSLLRKKDRL" } }, { "url": "https://www.uniprot.org/uniprot/A4UUI3#A4UUI4-1", "isoform_ac": "A4UUI4-1", "locus": { "end_pos": 105125625, "strand": "+", "start_pos": 105137021, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000196204", "id": "ENSMUST00000196204", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000142528", "id": "ENSMUSP00000142528", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A4UUI4-1|A4UUI3_MOUSE Computationally mapped isoform of Guanylate-binding protein 4 OS=Mus musculus OX=10090 GN=Gbp4 PE=1 SV=1 CANONICAL=A4UUI3-1", "length": 103, "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGWSHTGKSYLMNCLAGQNHVSLWAPPCSLRPRASGCGACPTPPSQSTGPPGHRGPGRCGKG" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:17472", "resource": "KEGG Pathway", "id": "mmu:17472", "name": "" } ], "reaction_participants": [], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934.1", "annotation": "GBP4 is a negative regulator of virus-triggered type I interferon (IFN-I) production, interacting as a novel protein targeting interferon regulatory factor (IRF)-7 and inhibiting its function.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934.1", "id": "NP_001242934.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934.1", "annotation": "Two splice variants of mGBP4 could be detected. One variant led to a premature stop codon after 312 bp. The second variant resulted in a transcript with a disrupted G2 domain.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934.1", "id": "NP_001242934.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2JDV3-1", "protein_name": "Guanylate-binding protein 6", "sequence": { "length": 611, "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGLYRTGKSYLMNCLAGQNHGFPLGSTVQSQTKGIWMWCMPHPTKPEHTLVLLDTEGLGDVEKGDPKNDLWIFALSVLLSSTFIYNSMITINHQALEQLHYVTELTELIRAKSSPNPAGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDDYLENALKLIPGDKPRMQASNSCRECIRLFFPNRKCFVFDRPTHDKELLQKLDSITEDQLDPKFQEVTKAFVSYIFTYAKIKTLKEGIKVTGNRLGILVTTYVNAINSGAVPCLDDAVTTLAQRENSVAVQKAADHYSEQMAQRLRLPTETLQELLDVHAACEKEAMAVFMEHSFKDENQQFLKKLVELIGENKELFLSKNEEASNKYCQEELDRLSKDFMENISTFFVPCGHKLYMDKREKIEHDYWQVPRKGVKASEVFQSFLQSQAFIESSILQADTALTAGEKAIAEERAQKVAAEKEQELLRQKQKEQQEYMEAQEKSHKENLEQLRRKLEQEREQDIKDHDMMLKKLMKDQKAFLEEGFKKKAEEMNKEIQQLRDVIKDKKRNTDRIKEALLNGFSTVLFHYLVRYLKHL" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/128731", "id": "128731", "database": "MGI" } ], "common_name": "Mouse", "organism": "Mus musculus", "gene_name": "Gbp6", "tax_id": 10090 }, { "uniprot_canonical_ac": "M0RDF8-1", "protein_name": "Guanylate-binding protein family member 6", "sequence": { "length": 565, "sequence": "VTQPQMAPICLVENHNERLSVNQKAIEILDKISQPVVVVAIVGLYRTGKSYLMNCLAGQNHSGMLGTSQRLPSGLYSAVADQGHLDVVRATPHQAKALVLLDTEGLGDVEKGDPKNDSWIFALAVLLSSTFVYNSLSTINHQALEQLYYVTELTKLIRARSSPNPDGIKNSTEFVSFFPDFVWTVRDFMLELTLNGKNITSDEYLENALKLIPGNSPRIQASNLPRECIRQFFPNRKCFVFDRPTHDKELLQKLETISEDQLDPNFREGTKAFVSYIFTYAKMKTLREGIKVTGNRLGTLVTTYVDAINSGAVPCLDDAVTTLAQRENSVAVQKAVDHYSEQMAQRLRLPTDTLQELLDEHTACEKEAISVFMEHSFKDENQLFLKKLVKLIGEKKGLFVLKNEEASDKYCQEELDRLSKDFMENISTFSVPGGHRLYVDMREKIERDYWQVPRKGVKASEVFQSFLQSQVIIESSILQADTALTAGEKAIAEERTQREAAEKEQELLRQKQREQQQLMEAQEKSNKENLEQLREKLVQERKQLIEEHNMMLEKQLKDQKAYLEE" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A4UUI3/", "id": "A4UUI3", "database": "OMA" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "gene_name": "Gbp6", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q000W5-1", "protein_name": "Guanylate-binding protein 10", "sequence": { "length": 611, "sequence": "MTQPQMAPICLVENHNEQLSVNQEAIEILDKISQPVVVVAIVGWSRTGKSYLMNCLAGQNHGFPLGSTVQSQTKGIWMWCMPHPTKPEHTLVLLDTEGLGDVEKGDPKNDLWIFALSVLLSSTFIYNSMITINHQALEQLHYVTELTELIRAKSSPNPAGIKNSTEFVSFFPDFVWIVRDFMLELKLNGEDITSDDYLENALKLIPGDKPRMQASNSCRECIRLFFPNRKCFVFDRPTHDKELLQKLDSITEDQLDPKFQEVTKAFVSYIFTYAKIKTLKEGIKVTGNKLGILVTTYVDAINSGAVPCLDDAVTTLAQRENSVAVQKAADHYSEQMAQRLRLPTETLQELLDVHAACEKEAMAVFMEHSFKDENQQFLKKLVELIGENKELFLSKNEEASNKYCQEELDRLSKDFMENISTFFVPCGHKLYMDKREKIEHDYWQVPRKGVKASEVFQSFLQSQAFIESSILQADTALTAGKKAIAEERAQKVAAEKEQDLLRQKQKEQQEYMEAQEKSHKENIEQLRRKLMQEREQLIKDHNMMLKKQLKDQKAFLEEGFKKKAEEMNKEIQQLRDVIKDKKRNTDRIKDALLNGFSTVLFHYLVRYLKHL" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/128731", "id": "128731", "database": "MGI" } ], "common_name": "Mouse", "organism": "Mus musculus", "gene_name": "Gbp10", "tax_id": 10090 }, { "uniprot_canonical_ac": "Q6ZN66-1", "protein_name": "Guanylate-binding protein 6", "sequence": { "length": 633, "sequence": "MESGPKMLAPVCLVENNNEQLLVNQQAIQILEKISQPVVVVAIVGLYRTGKSYLMNHLAGQNHGFPLGSTVQSETKGIWMWCVPHPSKPNHTLVLLDTEGLGDVEKGDPKNDSWIFALAVLLCSTFVYNSMSTINHQALEQLHYVTELTELIKAKSSPRPDGVEDSTEFVSFFPDFLWTVRDFTLELKLNGHPITEDEYLENALKLIQGNNPRVQTSNFPRECIRRFFPKRKCFVFDRPTNDKDLLANIEKVSEKQLDPKFQEQTNIFCSYIFTHARTKTLREGITVTGNRLGTLAVTYVEAINSGAVPCLENAVITLAQRENSAAVQRAADYYSQQMAQRVKLPTDTLQELLDMHAACEREAIAIFMEHSFKDENQEFQKKFMETTMNKKGDFLLQNEESSVQYCQAKLNELSKGLMESISAGSFSVPGGHKLYMETKERIEQDYWQVPRKGVKAKEVFQRFLESQMVIEESILQSDKALTDREKAVAVDRAKKEAAEKEQELLKQKLQEQQQQMEAQDKSRKENIAQLKEKLQMEREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGVSSLFKKHKLPF" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/128731", "id": "128731", "database": "MGI" } ], "common_name": "Human", "organism": "Homo sapiens", "gene_name": "GBP6", "tax_id": 9606 }, { "uniprot_canonical_ac": "Q8BTS3-1", "protein_name": "Guanylate-binding protein 9", "sequence": { "length": 619, "sequence": "MTQPQMAPICLVENHNEQLLVNQEAIEILEKISQPVVVVAIVGLYRTGKSYLMNCLAGQNHGFPLGSTVQSQTKGIWMWCMPHPTKPEHTLVLLDTEGLGDVEKSNPKNDSWIFALSVLLSSTFVYNSMSTINHQALEQLHYVTELTELIRSKSSRNPHGIKNSTEFVSFFPDFVWTVRDFMLELKLNGEDITSDEYLENALKLIPGYNPRVQASNSARECIRCFFPNRKCFVFDRPTHDRELLQKLETISEDQLDLKFREGTKAFVSYVFTYAKIKTLREGIKVTGNRLGTLVTTYVDAINSGAVPCLDDAMTSVARRENSVAVQKAADHYSEQMAQRLRLPTDTLQELLDVHAACEKEAMAVFMEHSFKDENQQFLKKLVEIISEKIAFFWLKNEEASNKYCQEELDRLSKDFMDNISTFSVPGGHRIYTDMRKKIERDYWQVPRKGVKACEVFQNFLQSQYIIESSILQADRALTAGEKAIAEERAQKEVAEKEQELLRQKQKEQQEYMEAQEKRNKENLEQLRRKLMQEREQDIKDHDMMLEKQLKDQKAFLEEGFTNKAEEINAEIERLEHNIKDKKENIGPILELIEKAFCAGVFSSLIMVALLTHNPSLLRK" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/128731", "id": "128731", "database": "MGI" } ], "common_name": "Mouse", "organism": "Mus musculus", "gene_name": "Gbp9", "tax_id": 10090 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934.1", "ac": "NP_001242934.1", "name": "macrophage activation 2 isoform 1", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" } ], "name": "GTPase activity", "id": "GO:0003924" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" } ], "name": "GTP binding", "id": "GO:0005525" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" } ], "name": "cytoplasmic vesicle", "id": "GO:0031410" } ], "total": 1, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "pmid": "22095711", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" } ], "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050830", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" } ], "name": "defense response to Gram-positive bacterium", "id": "GO:0050830" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001933", "pmid": "22095711", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" } ], "name": "negative regulation of protein phosphorylation", "id": "GO:0001933" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042308", "pmid": "22095711", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" } ], "name": "negative regulation of protein import into nucleus", "id": "GO:0042308" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031397", "pmid": "22095711", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" } ], "name": "negative regulation of protein ubiquitination", "id": "GO:0031397" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071346", "pmid": "18025219", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" } ], "name": "cellular response to interferon-gamma", "id": "GO:0071346" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042832", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" } ], "name": "defense response to protozoan", "id": "GO:0042832" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050688", "pmid": "22095711", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" } ], "name": "regulation of defense response to virus", "id": "GO:0050688" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032687", "pmid": "22095711", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" } ], "name": "negative regulation of interferon-alpha production", "id": "GO:0032687" } ], "total": 9, "name": "Biological Process" } ] }, "site_annotation": [ { "end_pos": 173, "annotation": "n_glycosylation_sequon", "start_pos": 171 }, { "end_pos": 428, "annotation": "n_glycosylation_sequon", "start_pos": 426 } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000079363", "id": "ENSMUSG00000079363", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16269", "id": "cd16269", "database": "CDD" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/17472", "id": "17472", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR003191", "id": "IPR003191", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR015894", "id": "IPR015894", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "id": "IPR027417", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR030386", "id": "IPR030386", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036543", "id": "IPR036543", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR037684", "id": "IPR037684", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:17472", "id": "mmu:17472", "database": "KEGG Pathway" }, { "url": "http://www.informatics.jax.org/marker/MGI:97072", "id": "97072", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/NDSFITR/", "id": "NDSFITR", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1027269at2759", "id": "1027269at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF02263", "id": "PF02263", "database": "Pfam" }, { "url": "http://pfam.xfam.org/family/PF02841", "id": "PF02841", "database": "Pfam" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934", "id": "NP_001242934", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001242934.1", "id": "NP_001242934.1", "database": "RefSeq" }, { "url": "https://www.rhea-db.org/rhea/19669", "id": "19669", "database": "Rhea" }, { "url": "https://www.uniprot.org/uniprot/A0A0G2JDT5", "id": "A0A0G2JDT5", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A0A0G2JDT5-1", "id": "A0A0G2JDT5-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A0A0G2JEJ5", "id": "A0A0G2JEJ5", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A0A0G2JEJ5-1", "id": "A0A0G2JEJ5-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A0A0G2JGT4", "id": "A0A0G2JGT4", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A0A0G2JGT4-1", "id": "A0A0G2JGT4-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A4UUI3", "id": "A4UUI3", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A4UUI3-1", "id": "A4UUI3-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A4UUI4", "id": "A4UUI4", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A4UUI4-1", "id": "A4UUI4-1", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 72042.0, "chemical_mass": 72042.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3", "name": "Gbp4", "locus": { "end_pos": 105115767, "strand": "-", "start_pos": 105139586, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000079363", "id": "ENSMUSG00000079363", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A4UUI3#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Guanylate binding protein 4.1" }, { "url": "https://www.uniprot.org/uniprot/A4UUI3#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Guanylate-binding protein 4" }, { "url": "https://www.uniprot.org/uniprot/A4UUI3#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Truncated guanylate binding protein 4" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A4UUI3", "type": "synonym", "resource": "RefSeq", "name": "guanylate-binding protein 4 homolog; guanylate nucleotide binding protein 4; macrophage activation 2" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A4UUI3", "type": "synonym", "resource": "RefSeq", "name": "macrophage activation 2 isoform 1" } ] }