{ "uniprot_canonical_ac": "A2RST1-1", "ptm_annotation": [], "sequence": { "header": "sp|A2RST1-1|MGST2_MOUSE Isoform 1 of Microsomal glutathione S-transferase 2 OS=Mus musculus OX=10090 GN=Mgst2 PE=2 SV=1 CANONICAL=A2RST1-1", "length": 147, "sequence": "MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAQQNSLEFYPVFIVMLWMAGWYFNQVFAACLGLLYIYARHKYFWGYAEAAEKRITGFRLSLGILTLLPVLAVLGVASRFLNEYLDFHVAKKLRKPF" }, "uniprot_id": "A0A0A6YWX7_MOUSE", "glycation": [], "keywords": [], "species": [ { "common_name": "Mouse", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "reaction_enzymes": [ { "gene_name": "Gsta3", "uniprot_ac": "A0A0G2JTB1", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2JTB1", "id": "A0A0G2JTB1", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2JTB1", "id": "A0A0G2JTB1", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "LOC103694879", "uniprot_ac": "A0A0G2K3C6", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2K3C6", "id": "A0A0G2K3C6", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2K3C6", "id": "A0A0G2K3C6", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTT4", "uniprot_ac": "A0A1W2PR19", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A1W2PR19", "id": "A0A1W2PR19", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A1W2PR19", "id": "A0A1W2PR19", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "", "uniprot_ac": "A0A1W2PRG0", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A1W2PRG0", "id": "A0A1W2PRG0", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A1W2PRG0", "id": "A0A1W2PRG0", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Mgst2", "uniprot_ac": "A2RST1", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "ec_number": "1.11.1.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstm6", "uniprot_ac": "B0BN47", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/B0BN47", "id": "B0BN47", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/B0BN47", "id": "B0BN47", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gsto1", "uniprot_ac": "O09131", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O09131", "id": "O09131", "database": "UniProtKB" } ], "ec_number": "1.20.4.2", "activity": "Methylarsonate + 2 glutathione = methylarsonite + glutathione disulfide + H(2)O." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O09131", "id": "O09131", "database": "UniProtKB" } ], "ec_number": "1.8.5.1", "activity": "2 glutathione + dehydroascorbate = glutathione disulfide + ascorbate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O09131", "id": "O09131", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O09131", "id": "O09131", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O09131", "id": "O09131", "database": "UniProtKB" } ], "ec_number": "1.8.5.1", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O09131", "id": "O09131", "database": "UniProtKB" } ], "ec_number": "1.20.4.2", "activity": "" } ] }, { "gene_name": "PTGES", "uniprot_ac": "O14684", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O14684", "id": "O14684", "database": "UniProtKB" } ], "ec_number": "1.11.1.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O14684", "id": "O14684", "database": "UniProtKB" } ], "ec_number": "5.3.99.3", "activity": "(5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-11-alpha,15-dihydroxy-9-oxoprosta-5,13-dienoate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O14684", "id": "O14684", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O14684", "id": "O14684", "database": "UniProtKB" } ], "ec_number": "5.3.99.3", "activity": "" } ] }, { "gene_name": "MGST3", "uniprot_ac": "O14880", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O14880", "id": "O14880", "database": "UniProtKB" } ], "ec_number": "1.11.1.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O14880", "id": "O14880", "database": "UniProtKB" } ], "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione." } ] }, { "gene_name": "GSTA4", "uniprot_ac": "O15217", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O15217", "id": "O15217", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O15217", "id": "O15217", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Hpgds", "uniprot_ac": "O35543", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O35543", "id": "O35543", "database": "UniProtKB" } ], "ec_number": "5.3.99.2", "activity": "(5Z,13E,15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E,15S)-9-alpha,15-dihydroxy-11-oxoprosta-5,13-dienoate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O35543", "id": "O35543", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O35543", "id": "O35543", "database": "UniProtKB" } ], "ec_number": "5.3.99.2", "activity": "" } ] }, { "gene_name": "Gstm6", "uniprot_ac": "O35660", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O35660", "id": "O35660", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O35660", "id": "O35660", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTZ1", "uniprot_ac": "O43708", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O43708", "id": "O43708", "database": "UniProtKB" } ], "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O43708", "id": "O43708", "database": "UniProtKB" } ], "ec_number": "5.2.1.2", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O43708", "id": "O43708", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." } ] }, { "gene_name": "LANCL1", "uniprot_ac": "O43813", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O43813", "id": "O43813", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O43813", "id": "O43813", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "HPGDS", "uniprot_ac": "O60760", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O60760", "id": "O60760", "database": "UniProtKB" } ], "ec_number": "5.3.99.2", "activity": "(5Z,13E,15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E,15S)-9-alpha,15-dihydroxy-11-oxoprosta-5,13-dienoate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O60760", "id": "O60760", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O60760", "id": "O60760", "database": "UniProtKB" } ], "ec_number": "5.3.99.2", "activity": "" } ] }, { "gene_name": "Lancl1", "uniprot_ac": "O89112", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O89112", "id": "O89112", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/O89112", "id": "O89112", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gsta1", "uniprot_ac": "P00502", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P00502", "id": "P00502", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P00502", "id": "P00502", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P00502", "id": "P00502", "database": "UniProtKB" } ], "ec_number": "1.11.1.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P00502", "id": "P00502", "database": "UniProtKB" } ], "ec_number": "5.3.3.-", "activity": "" } ] }, { "gene_name": "Gsta2", "uniprot_ac": "P04903", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P04903", "id": "P04903", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P04903", "id": "P04903", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstm1", "uniprot_ac": "P04905", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P04905", "id": "P04905", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P04905", "id": "P04905", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstp1", "uniprot_ac": "P04906", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P04906", "id": "P04906", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P04906", "id": "P04906", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstm7", "uniprot_ac": "P08009", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P08009", "id": "P08009", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P08009", "id": "P08009", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstm2", "uniprot_ac": "P08010", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P08010", "id": "P08010", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P08010", "id": "P08010", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Mgst1", "uniprot_ac": "P08011", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P08011", "id": "P08011", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P08011", "id": "P08011", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTA1", "uniprot_ac": "P08263", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P08263", "id": "P08263", "database": "UniProtKB" } ], "ec_number": "1.11.1.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P08263", "id": "P08263", "database": "UniProtKB" } ], "ec_number": "5.3.3.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P08263", "id": "P08263", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P08263", "id": "P08263", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTA2", "uniprot_ac": "P09210", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P09210", "id": "P09210", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P09210", "id": "P09210", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTP1", "uniprot_ac": "P09211", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P09211", "id": "P09211", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P09211", "id": "P09211", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTM1", "uniprot_ac": "P09488", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P09488", "id": "P09488", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P09488", "id": "P09488", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTT2", "uniprot_ac": "P0CG29", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P0CG29", "id": "P0CG29", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P0CG29", "id": "P0CG29", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTT2B", "uniprot_ac": "P0CG30", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P0CG30", "id": "P0CG30", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P0CG30", "id": "P0CG30", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "MGST1", "uniprot_ac": "P10620", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P10620", "id": "P10620", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P10620", "id": "P10620", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gsta2", "uniprot_ac": "P10648", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P10648", "id": "P10648", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P10648", "id": "P10648", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstm1", "uniprot_ac": "P10649", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P10649", "id": "P10649", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P10649", "id": "P10649", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gsta1", "uniprot_ac": "P13745", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P13745", "id": "P13745", "database": "UniProtKB" } ], "ec_number": "1.11.1.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P13745", "id": "P13745", "database": "UniProtKB" } ], "ec_number": "5.3.3.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P13745", "id": "P13745", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P13745", "id": "P13745", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gsta4", "uniprot_ac": "P14942", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P14942", "id": "P14942", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P14942", "id": "P14942", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstm2", "uniprot_ac": "P15626", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P15626", "id": "P15626", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P15626", "id": "P15626", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstp1", "uniprot_ac": "P19157", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P19157", "id": "P19157", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P19157", "id": "P19157", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstm3", "uniprot_ac": "P19639", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P19639", "id": "P19639", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P19639", "id": "P19639", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTM3", "uniprot_ac": "P21266", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P21266", "id": "P21266", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P21266", "id": "P21266", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gsta4", "uniprot_ac": "P24472", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P24472", "id": "P24472", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P24472", "id": "P24472", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstk1", "uniprot_ac": "P24473", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P24473", "id": "P24473", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P24473", "id": "P24473", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTM2", "uniprot_ac": "P28161", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P28161", "id": "P28161", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P28161", "id": "P28161", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gsta3", "uniprot_ac": "P30115", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P30115", "id": "P30115", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P30115", "id": "P30115", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTT1", "uniprot_ac": "P30711", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P30711", "id": "P30711", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P30711", "id": "P30711", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstt2", "uniprot_ac": "P30713", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P30713", "id": "P30713", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P30713", "id": "P30713", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstp2", "uniprot_ac": "P46425", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P46425", "id": "P46425", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P46425", "id": "P46425", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTM5", "uniprot_ac": "P46439", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P46439", "id": "P46439", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P46439", "id": "P46439", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstm5", "uniprot_ac": "P48774", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P48774", "id": "P48774", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P48774", "id": "P48774", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstz1", "uniprot_ac": "P57113", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P57113", "id": "P57113", "database": "UniProtKB" } ], "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P57113", "id": "P57113", "database": "UniProtKB" } ], "ec_number": "5.2.1.2", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P57113", "id": "P57113", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." } ] }, { "gene_name": "GSTO1", "uniprot_ac": "P78417", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P78417", "id": "P78417", "database": "UniProtKB" } ], "ec_number": "1.20.4.2", "activity": "Methylarsonate + 2 glutathione = methylarsonite + glutathione disulfide + H(2)O." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P78417", "id": "P78417", "database": "UniProtKB" } ], "ec_number": "1.8.5.1", "activity": "2 glutathione + dehydroascorbate = glutathione disulfide + ascorbate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P78417", "id": "P78417", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P78417", "id": "P78417", "database": "UniProtKB" } ], "ec_number": "1.20.4.2", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P78417", "id": "P78417", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/P78417", "id": "P78417", "database": "UniProtKB" } ], "ec_number": "1.8.5.1", "activity": "" } ] }, { "gene_name": "Gstt1", "uniprot_ac": "Q01579", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q01579", "id": "Q01579", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q01579", "id": "Q01579", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTM4", "uniprot_ac": "Q03013", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q03013", "id": "Q03013", "database": "UniProtKB" } ], "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q03013", "id": "Q03013", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q03013", "id": "Q03013", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTA3", "uniprot_ac": "Q16772", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q16772", "id": "Q16772", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q16772", "id": "Q16772", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "LTC4S", "uniprot_ac": "Q16873", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q16873", "id": "Q16873", "database": "UniProtKB" } ], "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q16873", "id": "Q16873", "database": "UniProtKB" } ], "ec_number": "2.5.1.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q16873", "id": "Q16873", "database": "UniProtKB" } ], "ec_number": "4.4.1.20", "activity": "" } ] }, { "gene_name": "Gstt4", "uniprot_ac": "Q4V8E6", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q4V8E6", "id": "Q4V8E6", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q4V8E6", "id": "Q4V8E6", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstm4", "uniprot_ac": "Q5BK56", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q5BK56", "id": "Q5BK56", "database": "UniProtKB" } ], "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q5BK56", "id": "Q5BK56", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q5BK56", "id": "Q5BK56", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Ltc4s", "uniprot_ac": "Q60860", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q60860", "id": "Q60860", "database": "UniProtKB" } ], "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q60860", "id": "Q60860", "database": "UniProtKB" } ], "ec_number": "2.5.1.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q60860", "id": "Q60860", "database": "UniProtKB" } ], "ec_number": "4.4.1.20", "activity": "" } ] }, { "gene_name": "Gstt2", "uniprot_ac": "Q61133", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q61133", "id": "Q61133", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q61133", "id": "Q61133", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstt1", "uniprot_ac": "Q64471", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q64471", "id": "Q64471", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q64471", "id": "Q64471", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gsto2", "uniprot_ac": "Q6AXV9", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6AXV9", "id": "Q6AXV9", "database": "UniProtKB" } ], "ec_number": "1.20.4.2", "activity": "Methylarsonate + 2 glutathione = methylarsonite + glutathione disulfide + H(2)O." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6AXV9", "id": "Q6AXV9", "database": "UniProtKB" } ], "ec_number": "1.8.5.1", "activity": "2 glutathione + dehydroascorbate = glutathione disulfide + ascorbate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6AXV9", "id": "Q6AXV9", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6AXV9", "id": "Q6AXV9", "database": "UniProtKB" } ], "ec_number": "1.20.4.2", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6AXV9", "id": "Q6AXV9", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6AXV9", "id": "Q6AXV9", "database": "UniProtKB" } ], "ec_number": "1.8.5.1", "activity": "" } ] }, { "gene_name": "Gsta6", "uniprot_ac": "Q6AXY0", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6AXY0", "id": "Q6AXY0", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6AXY0", "id": "Q6AXY0", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gm3776", "uniprot_ac": "Q6P8Q0", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6P8Q0", "id": "Q6P8Q0", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q6P8Q0", "id": "Q6P8Q0", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTA5", "uniprot_ac": "Q7RTV2", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q7RTV2", "id": "Q7RTV2", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q7RTV2", "id": "Q7RTV2", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstm7", "uniprot_ac": "Q80W21", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q80W21", "id": "Q80W21", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q80W21", "id": "Q80W21", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gsto2", "uniprot_ac": "Q8K2Q2", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8K2Q2", "id": "Q8K2Q2", "database": "UniProtKB" } ], "ec_number": "1.20.4.2", "activity": "Methylarsonate + 2 glutathione = methylarsonite + glutathione disulfide + H(2)O." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8K2Q2", "id": "Q8K2Q2", "database": "UniProtKB" } ], "ec_number": "1.8.5.1", "activity": "2 glutathione + dehydroascorbate = glutathione disulfide + ascorbate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8K2Q2", "id": "Q8K2Q2", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8K2Q2", "id": "Q8K2Q2", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8K2Q2", "id": "Q8K2Q2", "database": "UniProtKB" } ], "ec_number": "1.8.5.1", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8K2Q2", "id": "Q8K2Q2", "database": "UniProtKB" } ], "ec_number": "1.20.4.2", "activity": "" } ] }, { "gene_name": "Gstm4", "uniprot_ac": "Q8R5I6", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8R5I6", "id": "Q8R5I6", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8R5I6", "id": "Q8R5I6", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q8R5I6", "id": "Q8R5I6", "database": "UniProtKB" } ], "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione." } ] }, { "gene_name": "Mgst1", "uniprot_ac": "Q91VS7", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q91VS7", "id": "Q91VS7", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q91VS7", "id": "Q91VS7", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Ltc4s", "uniprot_ac": "Q925U2", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q925U2", "id": "Q925U2", "database": "UniProtKB" } ], "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q925U2", "id": "Q925U2", "database": "UniProtKB" } ], "ec_number": "2.5.1.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q925U2", "id": "Q925U2", "database": "UniProtKB" } ], "ec_number": "4.4.1.20", "activity": "" } ] }, { "gene_name": "MGST2", "uniprot_ac": "Q99735", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99735", "id": "Q99735", "database": "UniProtKB" } ], "ec_number": "1.11.1.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99735", "id": "Q99735", "database": "UniProtKB" } ], "ec_number": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99735", "id": "Q99735", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99735", "id": "Q99735", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstt3", "uniprot_ac": "Q99L20", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99L20", "id": "Q99L20", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q99L20", "id": "Q99L20", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Mgst3", "uniprot_ac": "Q9CPU4", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9CPU4", "id": "Q9CPU4", "database": "UniProtKB" } ], "ec_number": "1.11.1.-", "activity": "" } ] }, { "gene_name": "Gstt4", "uniprot_ac": "Q9D4P7", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9D4P7", "id": "Q9D4P7", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9D4P7", "id": "Q9D4P7", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstk1", "uniprot_ac": "Q9DCM2", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9DCM2", "id": "Q9DCM2", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9DCM2", "id": "Q9DCM2", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "GSTO2", "uniprot_ac": "Q9H4Y5", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9H4Y5", "id": "Q9H4Y5", "database": "UniProtKB" } ], "ec_number": "1.20.4.2", "activity": "Methylarsonate + 2 glutathione = methylarsonite + glutathione disulfide + H(2)O." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9H4Y5", "id": "Q9H4Y5", "database": "UniProtKB" } ], "ec_number": "1.8.5.1", "activity": "2 glutathione + dehydroascorbate = glutathione disulfide + ascorbate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9H4Y5", "id": "Q9H4Y5", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9H4Y5", "id": "Q9H4Y5", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Ptges", "uniprot_ac": "Q9JHF3", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9JHF3", "id": "Q9JHF3", "database": "UniProtKB" } ], "ec_number": "1.11.1.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9JHF3", "id": "Q9JHF3", "database": "UniProtKB" } ], "ec_number": "5.3.99.3", "activity": "(5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-11-alpha,15-dihydroxy-9-oxoprosta-5,13-dienoate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9JHF3", "id": "Q9JHF3", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9JHF3", "id": "Q9JHF3", "database": "UniProtKB" } ], "ec_number": "5.3.99.3", "activity": "" } ] }, { "gene_name": "Hpgds", "uniprot_ac": "Q9JHF7", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9JHF7", "id": "Q9JHF7", "database": "UniProtKB" } ], "ec_number": "5.3.99.2", "activity": "(5Z,13E,15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E,15S)-9-alpha,15-dihydroxy-11-oxoprosta-5,13-dienoate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9JHF7", "id": "Q9JHF7", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9JHF7", "id": "Q9JHF7", "database": "UniProtKB" } ], "ec_number": "5.3.99.2", "activity": "" } ] }, { "gene_name": "Ptges", "uniprot_ac": "Q9JM51", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9JM51", "id": "Q9JM51", "database": "UniProtKB" } ], "ec_number": "1.11.1.-", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9JM51", "id": "Q9JM51", "database": "UniProtKB" } ], "ec_number": "5.3.99.3", "activity": "(5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-11-alpha,15-dihydroxy-9-oxoprosta-5,13-dienoate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9JM51", "id": "Q9JM51", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9JM51", "id": "Q9JM51", "database": "UniProtKB" } ], "ec_number": "5.3.99.3", "activity": "" } ] }, { "gene_name": "Lancl1", "uniprot_ac": "Q9QX69", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9QX69", "id": "Q9QX69", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9QX69", "id": "Q9QX69", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstz1", "uniprot_ac": "Q9WVL0", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9WVL0", "id": "Q9WVL0", "database": "UniProtKB" } ], "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9WVL0", "id": "Q9WVL0", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9WVL0", "id": "Q9WVL0", "database": "UniProtKB" } ], "ec_number": "5.2.1.2", "activity": "" } ] }, { "gene_name": "GSTK1", "uniprot_ac": "Q9Y2Q3", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Y2Q3", "id": "Q9Y2Q3", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Y2Q3", "id": "Q9Y2Q3", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gstm5", "uniprot_ac": "Q9Z1B2", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Z1B2", "id": "Q9Z1B2", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Z1B2", "id": "Q9Z1B2", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] }, { "gene_name": "Gsto1", "uniprot_ac": "Q9Z339", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Z339", "id": "Q9Z339", "database": "UniProtKB" } ], "ec_number": "1.20.4.2", "activity": "Methylarsonate + 2 glutathione = methylarsonite + glutathione disulfide + H(2)O." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Z339", "id": "Q9Z339", "database": "UniProtKB" } ], "ec_number": "1.8.5.1", "activity": "2 glutathione + dehydroascorbate = glutathione disulfide + ascorbate." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Z339", "id": "Q9Z339", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Z339", "id": "Q9Z339", "database": "UniProtKB" } ], "ec_number": "1.20.4.2", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Z339", "id": "Q9Z339", "database": "UniProtKB" } ], "ec_number": "1.8.5.1", "activity": "" }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9Z339", "id": "Q9Z339", "database": "UniProtKB" } ], "ec_number": "2.5.1.18", "activity": "" } ] } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/26656251", "type": "PubMed", "id": "26656251" } ], "title": "Leukotriene C4 is the major trigger of stress-induced oxidative DNA damage.", "journal": "Nat. Commun.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "authors": "Rubinstein M., Barak S., Dvash E., Har-Tal M., Meir O.", "date": "2015" } ], "uniprot_ac": "A2RST1", "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RST1", "type": "synonym", "resource": "RefSeq", "name": "GST; GST2; MGST; MGST-II" }, { "url": "https://www.uniprot.org/uniprot/A2RST1", "type": "synonym", "resource": "UniProtKB", "name": "Gst2" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RST1", "type": "synonym", "resource": "RefSeq", "name": "Mgst2" }, { "url": "https://www.uniprot.org/uniprot/A2RST1", "type": "recommended", "resource": "UniProtKB", "name": "Mgst2" } ], "reactions": [ { "output_participant_list": [], "evidence": [ { "url": "https://www.rhea-db.org/rhea/16437", "id": "16437", "database": "Rhea" } ], "name": "", "cellular_location": "plasma membrane", "equation": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+)", "input_participant_list": [], "enzyme_list": [ "P00502-1", "Q6AXV9-1", "O35543-1", "Q9Z339-1", "A0A0G2JTB1-1", "Q6AXY0-1", "P24473-1", "P30713-1", "Q9QX69-1", "P04903-1", "P04906-1", "P08011-1", "P14942-1", "P57113-1", "Q01579-1", "Q4V8E6-1", "Q9Z1B2-1", "P08009-1", "P04905-1", "P08010-1", "B0BN47-1", "Q5BK56-1", "A0A0G2K3C6-1", "P21266-1", "Q16772-1", "P28161-1", "Q03013-1", "O60760-1", "Q9Y2Q3-1", "P78417-1", "P46439-1", "O15217-1", "Q9H4Y5-1", "P30711-1", "P09210-1", "P0CG30-1", "P0CG29-1", "Q7RTV2-1", "O43708-1", "A0A1W2PR19-1", "O43813-1", "P10620-1", "P08263-1", "Q99735-1", "P09211-1", "A0A1W2PRG0-1", "P09488-1", "Q80W21-1", "P10649-1", "A2RST1-1", "Q8R5I6-1", "Q64471-1", "Q8K2Q2-1", "P15626-1", "O09131-1", "Q9JHF7-1", "Q61133-1", "P10648-1", "Q9D4P7-1", "Q9WVL0-1", "Q91VS7-1", "P30115-1", "O35660-1", "P48774-1", "Q99L20-1", "P24472-1", "P46425-1", "P19639-1", "Q9DCM2-1", "P13745-1", "O89112-1", "Q6P8Q0-1", "P19157-1" ], "id": "16437", "summary": "" }, { "output_participant_list": [], "evidence": [ { "url": "https://www.rhea-db.org/rhea/17617", "id": "17617", "database": "Rhea" } ], "name": "", "cellular_location": "plasma membrane", "equation": "leukotriene C4 = glutathione + leukotriene A4", "input_participant_list": [], "enzyme_list": [ "Q925U2-1", "Q5BK56-1", "Q03013-1", "O14880-1", "Q16873-1", "Q99735-1", "A2RST1-1", "Q8R5I6-1", "Q60860-1" ], "id": "17617", "summary": "" }, { "output_participant_list": [], "evidence": [ { "url": "https://www.rhea-db.org/rhea/48620", "id": "48620", "database": "Rhea" } ], "name": "", "cellular_location": "plasma membrane", "equation": "(5S)-hydroperoxy-(6E,8Z,11Z,14Z)-eicosatetraenoate + 2 glutathione = (5S)-hydroxy-(6E,8Z,11Z,14Z)-eicosatetraenoate + glutathione disulfide + H2O", "input_participant_list": [], "enzyme_list": [ "Q9JHF3-1", "O14880-1", "Q99735-1", "O14684-1", "A2RST1-1", "Q9CPU4-1", "Q9JM51-1" ], "id": "48620", "summary": "" }, { "output_participant_list": [], "evidence": [ { "url": "https://www.rhea-db.org/rhea/51220", "id": "51220", "database": "Rhea" } ], "name": "", "cellular_location": "plasma membrane", "equation": "1-chloro-2,4-dinitrobenzene + glutathione = 2,4-dinitrophenyl-S-glutathione + chloride + H(+)", "input_participant_list": [], "enzyme_list": [ "Q9QX69-1", "Q9JHF3-1", "Q5BK56-1", "Q03013-1", "O43813-1", "Q99735-1", "O14684-1", "A2RST1-1", "Q8R5I6-1", "O89112-1", "Q9JM51-1" ], "id": "51220", "summary": "" }, { "output_participant_list": [], "evidence": [ { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-176059", "id": "R-MMU-176059", "database": "Reactome" } ], "name": "GST trimers transfer GS from GSH to luminal substrates", "cellular_location": "plasma membrane", "equation": "", "input_participant_list": [], "enzyme_list": [ "Q9CPU4-1", "Q91VS7-1", "A2RST1-1" ], "id": "R-MMU-176059", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp" }, { "output_participant_list": [], "evidence": [ { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5423653", "id": "R-MMU-5423653", "database": "Reactome" } ], "name": "MGST trimers transfer GS from GSH to AFXBO and AFNBO", "cellular_location": "plasma membrane", "equation": "", "input_participant_list": [], "enzyme_list": [ "Q9CPU4-1", "Q91VS7-1", "A2RST1-1" ], "id": "R-MMU-5423653", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp" } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2RST1#A0A0A6YWX7-1", "isoform_ac": "A0A0A6YWX7-1", "locus": { "end_pos": 51661249, "strand": "-", "start_pos": 51682470, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000159554", "id": "ENSMUST00000159554", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000141745", "id": "ENSMUSP00000141745", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A0A6YWX7-1|MGST2_MOUSE Computationally mapped isoform of Microsomal glutathione S-transferase 2 OS=Mus musculus OX=10090 GN=Mgst2 PE=2 SV=1 CANONICAL=A2RST1-1", "length": 82, "sequence": "MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAQQNSLEFYPVFIVMLWMAGWYFNQGSPVSD" } }, { "url": "https://www.uniprot.org/uniprot/A2RST1#A2RST1-1", "isoform_ac": "A2RST1-1", "locus": { "end_pos": 51661249, "strand": "-", "start_pos": 51682583, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000099106", "id": "ENSMUST00000099106", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000096705", "id": "ENSMUSP00000096705", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A2RST1-1|MGST2_MOUSE Isoform 1 of Microsomal glutathione S-transferase 2 OS=Mus musculus OX=10090 GN=Mgst2 PE=2 SV=1 CANONICAL=A2RST1-1", "length": 147, "sequence": "MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAQQNSLEFYPVFIVMLWMAGWYFNQVFAACLGLLYIYARHKYFWGYAEAAEKRITGFRLSLGILTLLPVLAVLGVASRFLNEYLDFHVAKKLRKPF" } }, { "url": "https://www.uniprot.org/uniprot/A2RST1#E0CZ62-1", "isoform_ac": "E0CZ62-1", "locus": { "end_pos": 51661249, "strand": "-", "start_pos": 51681869, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000161590", "id": "ENSMUST00000161590", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000125670", "id": "ENSMUSP00000125670", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|E0CZ62-1|E0CZ62_MOUSE Computationally mapped isoform of Microsomal glutathione S-transferase 2 OS=Mus musculus OX=10090 GN=Mgst2 PE=1 SV=1 CANONICAL=A2RST1-1", "length": 77, "sequence": "MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAHFCSLSGSPVHIRPSQVFLGLCRSR" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:211666", "resource": "KEGG Pathway", "id": "mmu:211666", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-156590", "description": "Glutathione conjugation", "resource": "Reactome", "id": "R-MMU-156590", "name": "Glutathione conjugation" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5423646", "description": "Aflatoxin activation and detoxification", "resource": "Reactome", "id": "R-MMU-5423646", "name": "Aflatoxin activation and detoxification" } ], "reaction_participants": [], "function": [ { "url": "https://www.uniprot.org/uniprot/A2RST1#function", "annotation": "Catalyzes several different glutathione-dependent reactions. Catalyzes the glutathione-dependent reduction of lipid hydroperoxides, such as 5-HPETE. Has glutathione transferase activity, toward xenobiotic electrophiles, such as 1-chloro-2, 4-dinitrobenzene (CDNB). Catalyzes also the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4 (LTC4) (By similarity). Involved in oxidative DNA damage induced by ER stress and anticancer agents by activating LTC4 biosynthetic machinery in nonimmune cells (PubMed:26656251).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1#function", "id": "A2RST1", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2JU12-1", "protein_name": "Microsomal glutathione S-transferase 2", "sequence": { "length": 128, "sequence": "GYFALQVGRVRLKYKIAPPAVTGSLEFERIFRAQQNSLEFYSVFIISLWMAGWYFNQVFATCLGLLYIYARHKYFWGYAEAAEKRIIGFRLSLGILALLTVLAVLGVASRFLDEYLDFHVAKKLKRPF" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A2RST1/", "id": "A2RST1", "database": "OMA" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "gene_name": "Mgst2", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q99735-1", "protein_name": "Microsomal glutathione S-transferase 2", "sequence": { "length": 147, "sequence": "MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIAKKLRRQF" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/1811", "id": "1811", "database": "MGI" } ], "common_name": "Human", "organism": "Homo sapiens", "gene_name": "MGST2", "tax_id": 9606 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778160.2", "ac": "NP_778160.2", "name": "microsomal glutathione S-transferase 2 isoform 1", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008047", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "enzyme activator activity", "id": "GO:0008047" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004364", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "glutathione transferase activity", "id": "GO:0004364" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043295", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "glutathione binding", "id": "GO:0043295" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004464", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "leukotriene-C4 synthase activity", "id": "GO:0004464" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "identical protein binding", "id": "GO:0042802" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004602", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "glutathione peroxidase activity", "id": "GO:0004602" } ], "total": 6, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "integral component of membrane", "id": "GO:0016021" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "endoplasmic reticulum membrane", "id": "GO:0005789" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005635", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "nuclear envelope", "id": "GO:0005635" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "endoplasmic reticulum", "id": "GO:0005783" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "plasma membrane", "id": "GO:0005886" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "membrane", "id": "GO:0016020" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "intracellular membrane-bounded organelle", "id": "GO:0043231" } ], "total": 8, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019370", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "leukotriene biosynthetic process", "id": "GO:0019370" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006750", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "glutathione biosynthetic process", "id": "GO:0006750" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "lipid metabolic process", "id": "GO:0006629" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046466", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "membrane lipid catabolic process", "id": "GO:0046466" } ], "total": 4, "name": "Biological Process" } ] }, "site_annotation": [], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000074604", "id": "ENSMUSG00000074604", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/211666", "id": "211666", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR001129", "id": "IPR001129", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR001446", "id": "IPR001446", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR023352", "id": "IPR023352", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:211666", "id": "mmu:211666", "database": "KEGG Pathway" }, { "url": "http://www.informatics.jax.org/marker/MGI:2448481", "id": "2448481", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/HKYFWGY/", "id": "HKYFWGY", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1609516at2759", "id": "1609516at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF01124", "id": "PF01124", "database": "Pfam" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-156590", "id": "R-MMU-156590", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5423646", "id": "R-MMU-5423646", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297411", "id": "NP_001297411", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297411.1", "id": "NP_001297411.1", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778160", "id": "NP_778160", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778160.2", "id": "NP_778160.2", "database": "RefSeq" }, { "url": "https://www.rhea-db.org/rhea/16437", "id": "16437", "database": "Rhea" }, { "url": "https://www.rhea-db.org/rhea/17617", "id": "17617", "database": "Rhea" }, { "url": "https://www.rhea-db.org/rhea/48620", "id": "48620", "database": "Rhea" }, { "url": "https://www.rhea-db.org/rhea/51220", "id": "51220", "database": "Rhea" }, { "url": "https://www.uniprot.org/uniprot/A0A0A6YWX7", "id": "A0A0A6YWX7", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A0A0A6YWX7-1", "id": "A0A0A6YWX7-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A2RST1-1", "id": "A2RST1-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/E0CZ62", "id": "E0CZ62", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/E0CZ62-1", "id": "E0CZ62-1", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 16786.0, "chemical_mass": 16786.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "name": "Mgst2", "locus": { "end_pos": 51682677, "strand": "+", "start_pos": 51660360, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000074604", "id": "ENSMUSG00000074604", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "1.11.1.-" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "2.5.1.18" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "4.4.1.20" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Glutathione peroxidase MGST2" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Leukotriene C4 synthase MGST2" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Microsomal GST-2" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Microsomal GST-II" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Microsomal glutathione S-transferase 2" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Microsomal glutathione S-transferase II" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RST1", "type": "synonym", "resource": "RefSeq", "name": "microsomal GST-2; microsomal GST-II; glutathione peroxidase MGST2; leukotriene C4 synthase MGST2; microsomal glutathione S-transferase II" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RST1", "type": "synonym", "resource": "RefSeq", "name": "microsomal glutathione S-transferase 2 isoform 1" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RST1", "type": "synonym", "resource": "RefSeq", "name": "microsomal glutathione S-transferase 2 isoform 2" } ] }