{
    "uniprot_canonical_ac": "A2ALI5-1", 
    "ptm_annotation": [], 
    "sequence": {
        "header": "sp|A2ALI5-1|AJAP1_MOUSE Isoform 1 of Adherens junction-associated protein 1  OS=Mus musculus OX=10090 GN=Ajap1 PE=2 SV=1 CANONICAL=A2ALI5-1", 
        "length": 412, 
        "sequence": "MWIQQLLGLSSMSIRWPGRSLGSHAWILIAMLQLAVDFPSCDSLGPGPEFRLLSRPQRPQRLWSLRSGPPTRLPTPAWSPRAARAERAHGPIQMQTPRARRAHRPRDQVATLGPKGGLTKPPAATRSSPSLASATASSSIVTAGAAEHQGLLRRGRRHTHDTEFNDFDFRGGRPTTETEFIAWGPTGDEDALESNTFPGGFGPTTVSILQTRKTTVATTTTTTAASTATAMTLQTKGVTESLDPWKRTPVGVSTTEPSTSPSSNGKDIQPPRILGETSGLAVHQIITITVSLIMVIAALITTLVLKNCCAPSGHTRRNSHQRKMNQQEESCQNLTDFTPARVPSSVDIFTAYNETLQCSHECVRASVPVYADETLHSTGEYKSTFNGNRTSSADRHLIPVAFVSEKWFEISC"
    }, 
    "uniprot_id": "", 
    "glycation": [], 
    "keywords": [], 
    "species": [
        {
            "common_name": "Mouse", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2ALI5", 
                    "id": "A2ALI5", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Mus musculus", 
            "taxid": 10090
        }
    ], 
    "reaction_enzymes": [], 
    "publication": [
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/11812828", 
                    "type": "PubMed", 
                    "id": "11812828"
                }
            ], 
            "title": "Gene expression in the developing mouse retina by EST sequencing and microarray analysis.", 
            "journal": "Nucleic acids research", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
                    "id": "NP_001092769.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Mu X, Zhao S, Pershad R, Hsieh TF, Scarpa A, Wang SW, White RA, Beremand PD, Thomas TL, Gan L, Klein WH", 
            "date": "2001"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/14595118", 
                    "type": "PubMed", 
                    "id": "14595118"
                }
            ], 
            "title": "Novel membrane protein shrew-1 targets to cadherin-mediated junctions in polarized epithelial cells.", 
            "journal": "Molecular biology of the cell", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
                    "id": "NP_001092769.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Bharti S, Handrow-Metzmacher H, Zickenheiner S, Zeitvogel A, Baumann R, Starzinski-Powitz A", 
            "date": "2004"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/16516881", 
                    "type": "PubMed", 
                    "id": "16516881"
                }
            ], 
            "title": "Molecular mapping of developing dorsal horn-enriched genes by microarray and dorsal/ventral subtractive screening.", 
            "journal": "Developmental biology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
                    "id": "NP_001092769.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Li MZ, Wang JS, Jiang DJ, Xiang CX, Wang FY, Zhang KH, Williams PR, Chen ZF", 
            "date": "2006"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/17267690", 
                    "type": "PubMed", 
                    "id": "17267690"
                }
            ], 
            "title": "Junction protein shrew-1 influences cell invasion and interacts with invasion-promoting protein CD147.", 
            "journal": "Molecular biology of the cell", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
                    "id": "NP_001092769.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Schreiner A, Ruonala M, Jakob V, Suthaus J, Boles E, Wouters F, Starzinski-Powitz A", 
            "date": "2007"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/24194600", 
                    "type": "PubMed", 
                    "id": "24194600"
                }
            ], 
            "title": "The International Mouse Phenotyping Consortium Web Portal, a unified point of access for knockout mice and related phenotyping data.", 
            "journal": "Nucleic acids research", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
                    "id": "NP_001092769.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Koscielny G, Yaikhom G, Iyer V, Meehan TF, Morgan H, Atienza-Herrero J, Blake A, Chen CK, Easty R, Di Fenza A, Fiegel T, Grifiths M, Horne A, Karp NA, Kurbatova N, Mason JC, Matthews P, Oakley DJ, Qazi A, Regnart J, Retha A, Santos LA, Sneddon DJ, Warren J, Westerberg H, Wilson RJ, Melvin DG, Smedley D, Brown SD, Flicek P, Skarnes WC, Mallon AM, Parkinson H", 
            "date": "2014"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/25245104", 
                    "type": "PubMed", 
                    "id": "25245104"
                }
            ], 
            "title": "Tbx5 is required for avian and Mammalian epicardial formation and coronary vasculogenesis.", 
            "journal": "Circulation research", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
                    "id": "NP_001092769.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Diman NY, Brooks G, Kruithof BP, Elemento O, Seidman JG, Seidman CE, Basson CT, Hatcher CJ", 
            "date": "2014"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/27870635", 
                    "type": "PubMed", 
                    "id": "27870635"
                }
            ], 
            "title": "Alternative exon usage creates novel transcript variants of tumor suppressor SHREW-1 gene with differential tissue expression profile.", 
            "journal": "Biology open", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
                    "id": "NP_001092769.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Klemmt PA, Resch E, Smyrek I, Engels K, Stelzer EH, Starzinski-Powitz A", 
            "date": "2016"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/30597727", 
                    "type": "PubMed", 
                    "id": "30597727"
                }
            ], 
            "title": "MiR-552 promotes the proliferation, migration and EMT of hepatocellular carcinoma cells by inhibiting AJAP1 expression.", 
            "journal": "Journal of cellular and molecular medicine", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
                    "id": "NP_001092769.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Qu W, Wen X, Su K, Gou W", 
            "date": "2019"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/30902970", 
                    "type": "PubMed", 
                    "id": "30902970"
                }
            ], 
            "title": "Complex formation of APP with GABAB receptors links axonal trafficking to amyloidogenic processing.", 
            "journal": "Nature communications", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
                    "id": "NP_001092769.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Dinamarca MC, Raveh A, Schneider A, Fritzius T, Fruh S, Rem PD, Stawarski M, Lalanne T, Turecek R, Choo M, Besseyrias V, Bildl W, Bentrop D, Staufenbiel M, Gassmann M, Fakler B, Schwenk J, Bettler B", 
            "date": "2019"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/32067740", 
                    "type": "PubMed", 
                    "id": "32067740"
                }
            ], 
            "title": "AJAP1 affects behavioral changes and GABABR1 level in epileptic mice.", 
            "journal": "Biochemical and biophysical research communications", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
                    "id": "NP_001092769.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Zhang M, Zhou X, Jiang W, Li M, Zhou R, Zhou S", 
            "date": "2020"
        }
    ], 
    "uniprot_ac": "A2ALI5", 
    "gene_names": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2ALI5", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "Ajap1"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2ALI5", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "Ajap1"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2ALI5", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "Gm573"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2ALI5", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "Gm573"
        }
    ], 
    "reactions": [], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A2ALI5#A2ALI5-1", 
            "isoform_ac": "A2ALI5-1", 
            "locus": {
                "end_pos": 153382268, 
                "strand": "+", 
                "start_pos": 153482157, 
                "chromosome": "4", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUST00000105646", 
                        "id": "ENSMUST00000105646", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSP00000101271", 
                        "id": "ENSMUSP00000101271", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "sp|A2ALI5-1|AJAP1_MOUSE Isoform 1 of Adherens junction-associated protein 1  OS=Mus musculus OX=10090 GN=Ajap1 PE=2 SV=1 CANONICAL=A2ALI5-1", 
                "length": 412, 
                "sequence": "MWIQQLLGLSSMSIRWPGRSLGSHAWILIAMLQLAVDFPSCDSLGPGPEFRLLSRPQRPQRLWSLRSGPPTRLPTPAWSPRAARAERAHGPIQMQTPRARRAHRPRDQVATLGPKGGLTKPPAATRSSPSLASATASSSIVTAGAAEHQGLLRRGRRHTHDTEFNDFDFRGGRPTTETEFIAWGPTGDEDALESNTFPGGFGPTTVSILQTRKTTVATTTTTTAASTATAMTLQTKGVTESLDPWKRTPVGVSTTEPSTSPSSNGKDIQPPRILGETSGLAVHQIITITVSLIMVIAALITTLVLKNCCAPSGHTRRNSHQRKMNQQEESCQNLTDFTPARVPSSVDIFTAYNETLQCSHECVRASVPVYADETLHSTGEYKSTFNGNRTSSADRHLIPVAFVSEKWFEISC"
            }
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2ALI5#D6RH95-1", 
            "isoform_ac": "D6RH95-1", 
            "locus": {
                "end_pos": 153385019, 
                "strand": "+", 
                "start_pos": 153482157, 
                "chromosome": "4", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUST00000149177", 
                        "id": "ENSMUST00000149177", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSP00000116651", 
                        "id": "ENSMUSP00000116651", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "tr|D6RH95-1|D6RH95_MOUSE Computationally mapped isoform of Adherens junction-associated protein 1  OS=Mus musculus OX=10090 GN=Ajap1 PE=4 SV=1 CANONICAL=A2ALI5-1", 
                "length": 49, 
                "sequence": "MWIQQLLGLRSGCASDHHHHRLPHHGHRCAHHNSCLKKLLCPKRAHSEE"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:230959", 
            "resource": "KEGG Pathway", 
            "id": "mmu:230959", 
            "name": ""
        }
    ], 
    "reaction_participants": [], 
    "function": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
            "annotation": "AJAP1 affects behavioral changes and GABABR1 level in epileptic mice.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
                    "id": "NP_001092769.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2ALI5#function", 
            "annotation": "Plays a role in cell adhesion and cell migration.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2ALI5#function", 
                    "id": "A2ALI5", 
                    "database": "UniProtKB"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
            "annotation": "The findings suggested that miR-552 promotes hepatocellular carcinoma oncogenesis and progression by inhibiting AJAP1 expression.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
                    "id": "NP_001092769.1", 
                    "database": "RefSeq"
                }
            ]
        }
    ], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q4W8E7-1", 
            "protein_name": "Adherens junction-associated protein 1", 
            "sequence": {
                "length": 411, 
                "sequence": "MWIQQLLGLSSMPIRWPGRSLGSHLWILIAMLQLAVDFPSCDSLGPGPEFRLLSRPQRPQRLWSLRTGPPTRLPTPAWSPRAARAERAHGPIQMQTPRARRAHRPRDQVATLGPKGGLTKPPAATRSSPSLTSASASSSMTAGAAEHQSLLKRGRRHTHDAEFNDFDFHGGRPTTETEFIAWGPTGDEEALESNTFPGGFGPTTVSILQTRKTTMAATTTTTAASTATAMTLQTKGVTESLDPWKRTPVGVSTTEPSTSPSNNGKDIQPPRILGETSGLAVHQIITITVSLIMVIAALITTLVLKNCCAPSGHTRRNSHQRKMNQQEESCQNLTDFTPARVPSSVDIFTAYNETLQCSHECVRASVPVYADETLHSTGEYKSTFNGNRSSSADRHLIPVAFVSEKWFEISC"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/10312", 
                    "id": "10312", 
                    "database": "MGI"
                }
            ], 
            "common_name": "Rat", 
            "organism": "Rattus norvegicus", 
            "gene_name": "Ajap1", 
            "tax_id": 10116
        }, 
        {
            "uniprot_canonical_ac": "Q9UKB5-1", 
            "protein_name": "Adherens junction-associated protein 1", 
            "sequence": {
                "length": 411, 
                "sequence": "MWIQQLLGLSSMSIRWPGRPLGSHAWILIAMFQLAVDLPACEALGPGPEFWLLPRSPPRPPRLWSFRSGQPARVPAPVWSPRPPRVERIHGQMQMPRARRAHRPRDQAAALVPKAGLAKPPAAAKSSPSLASSSSSSSSAVAGGAPEQQALLRRGKRHLQGDGLSSFDSRGSRPTTETEFIAWGPTGDEEALESNTFPGVYGPTTVSILQTRKTTVAATTTTTTTATPMTLQTKGFTESLDPRRRIPGGVSTTEPSTSPSNNGEVTQPPRILGEASGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNTRRNSHQRKTNQQEESCQNLTDFPSARVPSSLDIFTAYNETLQCSHECVRASVPVYTDETLHSTTGEYKSTFNGNRPSSSDRHLIPVAFVSEKWFEISC"
            }, 
            "evidence": [
                {
                    "url": "https://omabrowser.org/oma/group/A2ALI5/", 
                    "id": "A2ALI5", 
                    "database": "OMA"
                }, 
                {
                    "url": "http://www.informatics.jax.org/homology/10312", 
                    "id": "10312", 
                    "database": "MGI"
                }
            ], 
            "common_name": "Human", 
            "organism": "Homo sapiens", 
            "gene_name": "AJAP1", 
            "tax_id": 9606
        }
    ], 
    "interactions": [], 
    "synthesized_glycans": [], 
    "snv": [], 
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb", 
            "label": "Isoforms"
        }, 
        {
            "name": "homologset.mgi", 
            "label": "MGI Homologs"
        }, 
        {
            "name": "homologset.oma", 
            "label": "OMA Homologs"
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
        "ac": "NP_001092769.1", 
        "name": "adherens junction-associated protein 1", 
        "summary": ""
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2ALI5", 
                                "id": "A2ALI5", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "protein-containing complex binding", 
                        "id": "GO:0044877"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008013", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2ALI5", 
                                "id": "A2ALI5", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "beta-catenin binding", 
                        "id": "GO:0008013"
                    }
                ], 
                "total": 2, 
                "name": "Molecular Function"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005912", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2ALI5", 
                                "id": "A2ALI5", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "adherens junction", 
                        "id": "GO:0005912"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2ALI5", 
                                "id": "A2ALI5", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cell surface", 
                        "id": "GO:0009986"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2ALI5", 
                                "id": "A2ALI5", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "basolateral plasma membrane", 
                        "id": "GO:0016323"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2ALI5", 
                                "id": "A2ALI5", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "apical plasma membrane", 
                        "id": "GO:0016324"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009898", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2ALI5", 
                                "id": "A2ALI5", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cytoplasmic side of plasma membrane", 
                        "id": "GO:0009898"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044214", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2ALI5", 
                                "id": "A2ALI5", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "spanning component of plasma membrane", 
                        "id": "GO:0044214"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044291", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2ALI5", 
                                "id": "A2ALI5", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cell-cell contact zone", 
                        "id": "GO:0044291"
                    }
                ], 
                "total": 7, 
                "name": "Cellular Component"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2ALI5", 
                                "id": "A2ALI5", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "cell adhesion", 
                        "id": "GO:0007155"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001953", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2ALI5", 
                                "id": "A2ALI5", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "negative regulation of cell-matrix adhesion", 
                        "id": "GO:0001953"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061045", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2ALI5", 
                                "id": "A2ALI5", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "negative regulation of wound healing", 
                        "id": "GO:0061045"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030860", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2ALI5", 
                                "id": "A2ALI5", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "regulation of polarized epithelial cell differentiation", 
                        "id": "GO:0030860"
                    }
                ], 
                "total": 4, 
                "name": "Biological Process"
            }
        ]
    }, 
    "site_annotation": [
        {
            "end_pos": 335, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 333
        }, 
        {
            "end_pos": 355, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 353
        }, 
        {
            "end_pos": 390, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 388
        }
    ], 
    "pro_annotation": [], 
    "crossref": [
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000039546", 
            "id": "ENSMUSG00000039546", 
            "database": "Bgee"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/230959", 
            "id": "230959", 
            "database": "GeneID"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR029198", 
            "id": "IPR029198", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR039239", 
            "id": "IPR039239", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:230959", 
            "id": "mmu:230959", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "http://www.informatics.jax.org/marker/MGI:2685419", 
            "id": "2685419", 
            "database": "MGI"
        }, 
        {
            "url": "https://omabrowser.org/oma/group/NGRHNSH/", 
            "id": "NGRHNSH", 
            "database": "OMA"
        }, 
        {
            "url": "http://www.orthodb.org/?query=770398at2759", 
            "id": "770398at2759", 
            "database": "OrthoDB"
        }, 
        {
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR32422", 
            "id": "PTHR32422", 
            "database": "PANTHER"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF15298", 
            "id": "PF15298", 
            "database": "Pfam"
        }, 
        {
            "url": "http://purl.obolibrary.org/obo/PR_PR_A2ALI5", 
            "id": "PR_A2ALI5", 
            "database": "PRO"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769", 
            "id": "NP_001092769", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001092769.1", 
            "id": "NP_001092769.1", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2ALI5", 
            "id": "A2ALI5", 
            "database": "UniProtKB"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2ALI5-1", 
            "id": "A2ALI5-1", 
            "database": "UniProtKB"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/D6RH95", 
            "id": "D6RH95", 
            "database": "UniProtKB"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/D6RH95-1", 
            "id": "D6RH95-1", 
            "database": "UniProtKB"
        }
    ], 
    "expression_disease": [], 
    "glycosylation": [], 
    "mutagenesis": [], 
    "disease": [], 
    "phosphorylation": [], 
    "mass": {
        "monoisotopic_mass": 44772.0, 
        "chemical_mass": 44772.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A2ALI5", 
            "name": "Ajap1", 
            "locus": {
                "end_pos": 153373221, 
                "strand": "-", 
                "start_pos": 153482811, 
                "chromosome": "4", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSG00000039546", 
                        "id": "ENSMUSG00000039546", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ], 
    "protein_names": [
        {
            "url": "https://www.uniprot.org/uniprot/A2ALI5#names_and_taxonomy", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "Adherens junction-associated protein 1"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2ALI5", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "adherens junction-associated protein 1"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2ALI5", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "likely ortholog of H. sapiens transmembrane protein SHREW1"
        }
    ]
}