{
    "uniprot_canonical_ac": "A2AJ77-1", 
    "ptm_annotation": [], 
    "sequence": {
        "header": "sp|A2AJ77-1|PRD12_MOUSE Isoform 1 of PR domain zinc finger protein 12  OS=Mus musculus OX=10090 GN=Prdm12 PE=2 SV=1 CANONICAL=A2AJ77-1", 
        "length": 365, 
        "sequence": "MMGSVLPAEALVLKTGLKAPGLALAEVITSDILHSFLYGRWRNVLGEQLLEDKSHHASPKTAFTAEVLAQSFSGEVQKLSSLVLPVEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGRVIAPEHVDICKNNNLMWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEEEQKKNKHEDFHPADSATGTAGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPALPAPHAHAPALAAAAAAAAAAHHLPAMVL"
    }, 
    "uniprot_id": "", 
    "glycation": [], 
    "keywords": [], 
    "species": [
        {
            "common_name": "Mouse", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                    "id": "A2AJ77", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Mus musculus", 
            "taxid": 10090
        }
    ], 
    "reaction_enzymes": [], 
    "publication": [
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/23856557", 
                    "type": "PubMed", 
                    "id": "23856557"
                }
            ], 
            "title": "Prdm12 is induced by retinoic acid and exhibits anti-proliferative properties through the cell cycle modulation of P19 embryonic carcinoma cells.", 
            "journal": "Cell structure and function", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
                    "id": "NP_001116834.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Yang CM, Shinkai Y", 
            "date": "2013"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/25182747", 
                    "type": "PubMed", 
                    "id": "25182747"
                }
            ], 
            "title": "Wnt/beta-catenin signaling regulates sequential fate decisions of murine cortical precursor cells.", 
            "journal": "Stem cells (Dayton, Ohio)", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
                    "id": "NP_001116834.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Draganova K, Zemke M, Zurkirchen L, Valenta T, Cantu C, Okoniewski M, Schmid MT, Hoffmans R, Gotz M, Basler K, Sommer L", 
            "date": "2015"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/26005867", 
                    "type": "PubMed", 
                    "id": "26005867"
                }
            ], 
            "title": "Transcriptional regulator PRDM12 is essential for human pain perception.", 
            "journal": "Nat. Genet.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                    "id": "A2AJ77", 
                    "database": "UniProtKB"
                }, 
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
                    "id": "NP_001116834.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Irvine A.D., Strom T.M., Stucka R., Watson R.M., Wieland T., Pereira D., Bergmann C., De Jonghe P., Valente E.M., Reimann F., Chrast R., Baumgartner M., Dusl M., Willems P.J., Woods C.G., Weiss C., Auer-Grumbach M., Baets J., Parman Y., Reilly M.M., Schabhuettl M., Senderek J., Windhager R., Weis J., Kurth I., Hertz J.M., Carvalho O.P., Karbani G., Nicholas A.K., Rautenstrauss B., Chen Y.C., Michiue T., Zitzelsberger M., Heinritz W., Graul-Neumann L., Passarge E., Nahorski M.S., Moog U., Murphy S.M., Stendel C., Restrepo C.M., Cilio M.R., McAleer M.A., Katona I., Bennett D.L., Themistocleous A.C., Shaikh S.S., Young G.T., Jensen U.B., Cho L.T., Finke C., Kropatsch R., Matsukawa S., McHugh J.C., Moore A.W., Samara C., Schmid A.B., Stafford F., von Au K.", 
            "date": "2015"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/30917305", 
                    "type": "PubMed", 
                    "id": "30917305"
                }
            ], 
            "title": "PRDM12 Is Required for Initiation of the Nociceptive Neuron Lineage during Neurogenesis.", 
            "journal": "Cell reports", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
                    "id": "NP_001116834.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Bartesaghi L, Wang Y, Fontanet P, Wanderoy S, Berger F, Wu H, Akkuratova N, Boucanova F, Medard JJ, Petitpre C, Landy MA, Zhang MD, Harrer P, Stendel C, Stucka R, Dusl M, Kastriti ME, Croci L, Lai HC, Consalez GG, Pattyn A, Ernfors P, Senderek J, Adameyko I, Lallemend F, Hadjab S, Chrast R", 
            "date": "2019"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/30917309", 
                    "type": "PubMed", 
                    "id": "30917309"
                }
            ], 
            "title": "Prdm12 Directs Nociceptive Sensory Neuron Development by Regulating the Expression of the NGF Receptor TrkA.", 
            "journal": "Cell reports", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
                    "id": "NP_001116834.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Desiderio S, Vermeiren S, Van Campenhout C, Kricha S, Malki E, Richts S, Fletcher EV, Vanwelden T, Schmidt BZ, Henningfeld KA, Pieler T, Woods CG, Nagy V, Verfaillie C, Bellefroid EJ", 
            "date": "2019"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/32000999", 
                    "type": "PubMed", 
                    "id": "32000999"
                }
            ], 
            "title": "Investigation of PRDM7 and PRDM12 expression pattern during mouse embryonic development by using a modified passive clearing technique.", 
            "journal": "Biochemical and biophysical research communications", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
                    "id": "NP_001116834.1", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Woo J, Kang H, Lee EY, Park S, Cho YE", 
            "date": "2020"
        }
    ], 
    "uniprot_ac": "A2AJ77", 
    "gene_names": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2AJ77", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "Gm998"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AJ77", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "Gm998"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2AJ77", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "Prdm12"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AJ77", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "Prdm12"
        }
    ], 
    "reactions": [], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A2AJ77#A2AJ77-1", 
            "isoform_ac": "A2AJ77-1", 
            "locus": {
                "end_pos": 31640099, 
                "strand": "-", 
                "start_pos": 31654481, 
                "chromosome": "2", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUST00000113470", 
                        "id": "ENSMUST00000113470", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSP00000109098", 
                        "id": "ENSMUSP00000109098", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "sp|A2AJ77-1|PRD12_MOUSE Isoform 1 of PR domain zinc finger protein 12  OS=Mus musculus OX=10090 GN=Prdm12 PE=2 SV=1 CANONICAL=A2AJ77-1", 
                "length": 365, 
                "sequence": "MMGSVLPAEALVLKTGLKAPGLALAEVITSDILHSFLYGRWRNVLGEQLLEDKSHHASPKTAFTAEVLAQSFSGEVQKLSSLVLPVEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGRVIAPEHVDICKNNNLMWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEEEQKKNKHEDFHPADSATGTAGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPALPAPHAHAPALAAAAAAAAAAHHLPAMVL"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:381359", 
            "resource": "KEGG Pathway", 
            "id": "mmu:381359", 
            "name": ""
        }
    ], 
    "reaction_participants": [], 
    "function": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
            "annotation": "Investigation of PRDM7 and PRDM12 expression pattern during mouse embryonic development by using a modified passive clearing technique.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
                    "id": "NP_001116834.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AJ77#function", 
            "annotation": "Involved in the positive regulation of histone H3-K9 dimethylation.", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2AJ77#function", 
                    "id": "A2AJ77", 
                    "database": "UniProtKB"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
            "annotation": "Prdm12 expression is restricted to developing and adult nociceptors", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
                    "id": "NP_001116834.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
            "annotation": "Prdm12 is induced by the retinoic acid signaling in vivo, and may regulate neural differentiation during animal development.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
                    "id": "NP_001116834.1", 
                    "database": "RefSeq"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
            "annotation": "Results demonstrate that PRDM12 is necessary for the generation of the entire lineage of pain-initiating neurons", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
                    "id": "NP_001116834.1", 
                    "database": "RefSeq"
                }
            ]
        }
    ], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "D3ZEJ0-1", 
            "protein_name": "PR domain zinc finger protein 12", 
            "sequence": {
                "length": 365, 
                "sequence": "MMGSVLPAEALVLKTGLKAPGLALAEVITSDILHSFLYGRWRNVLGEQLLEDKSHHASPKTAFTAEVLAQSFSGEVQKLSSLVLPVEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGRVIAPEHVDICKNNNLMWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEEEQKKNKHEDFHPADSATGTAGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPALPAPHAHAPALAAAAAAAAAAHHLPAMVL"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/10999", 
                    "id": "10999", 
                    "database": "MGI"
                }, 
                {
                    "url": "https://omabrowser.org/oma/group/A2AJ77/", 
                    "id": "A2AJ77", 
                    "database": "OMA"
                }
            ], 
            "common_name": "Rat", 
            "organism": "Rattus norvegicus", 
            "gene_name": "Prdm12", 
            "tax_id": 10116
        }, 
        {
            "uniprot_canonical_ac": "Q9H4Q4-1", 
            "protein_name": "PR domain zinc finger protein 12", 
            "sequence": {
                "length": 367, 
                "sequence": "MMGSVLPAEALVLKTGLKAPGLALAEVITSDILHSFLYGRWRNVLGEQLFEDKSHHASPKTAFTAEVLAQSFSGEVQKLSSLVLPAEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGRVIAPEHVDICKNNNLMWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEEDQKKNKHEDFHPADSAAGPAGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPALPAPHAHAPALAAAAAAAAAAAAHHLPAMVL"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/10999", 
                    "id": "10999", 
                    "database": "MGI"
                }, 
                {
                    "url": "https://omabrowser.org/oma/group/A2AJ77/", 
                    "id": "A2AJ77", 
                    "database": "OMA"
                }
            ], 
            "common_name": "Human", 
            "organism": "Homo sapiens", 
            "gene_name": "PRDM12", 
            "tax_id": 9606
        }
    ], 
    "interactions": [], 
    "synthesized_glycans": [], 
    "snv": [], 
    "cluster_types": [
        {
            "name": "homologset.mgi", 
            "label": "MGI Homologs"
        }, 
        {
            "name": "homologset.oma", 
            "label": "OMA Homologs"
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
        "ac": "NP_001116834.1", 
        "name": "PR domain zinc finger protein 12", 
        "summary": ""
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990226", 
                        "pmid": "26005867", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "histone methyltransferase binding", 
                        "id": "GO:1990226"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "DNA binding", 
                        "id": "GO:0003677"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "metal ion binding", 
                        "id": "GO:0046872"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008168", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "methyltransferase activity", 
                        "id": "GO:0008168"
                    }
                ], 
                "total": 4, 
                "name": "Molecular Function"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", 
                        "pmid": "26005867", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "nucleus", 
                        "id": "GO:0005634"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "nucleoplasm", 
                        "id": "GO:0005654"
                    }
                ], 
                "total": 2, 
                "name": "Cellular Component"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", 
                        "pmid": "26443638", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "negative regulation of transcription by RNA polymerase II", 
                        "id": "GO:0000122"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031175", 
                        "pmid": "26005867", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "neuron projection development", 
                        "id": "GO:0031175"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019233", 
                        "pmid": "26005867", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "sensory perception of pain", 
                        "id": "GO:0019233"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050965", 
                        "pmid": "26005867", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "detection of temperature stimulus involved in sensory perception of pain", 
                        "id": "GO:0050965"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010468", 
                        "pmid": "21873635", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "regulation of gene expression", 
                        "id": "GO:0010468"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022008", 
                        "pmid": "19050759", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "neurogenesis", 
                        "id": "GO:0022008"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051574", 
                        "pmid": "26005867", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "positive regulation of histone H3-K9 methylation", 
                        "id": "GO:0051574"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900111", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "positive regulation of histone H3-K9 dimethylation", 
                        "id": "GO:1900111"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032259", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AJ77", 
                                "id": "A2AJ77", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "methylation", 
                        "id": "GO:0032259"
                    }
                ], 
                "total": 9, 
                "name": "Biological Process"
            }
        ]
    }, 
    "site_annotation": [], 
    "pro_annotation": [], 
    "crossref": [
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000079466", 
            "id": "ENSMUSG00000079466", 
            "database": "Bgee"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/381359", 
            "id": "381359", 
            "database": "GeneID"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR001214", 
            "id": "IPR001214", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", 
            "id": "IPR013087", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017126", 
            "id": "IPR017126", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", 
            "id": "IPR036236", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:381359", 
            "id": "mmu:381359", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "http://www.informatics.jax.org/marker/MGI:2685844", 
            "id": "2685844", 
            "database": "MGI"
        }, 
        {
            "url": "https://omabrowser.org/oma/group/TQNTFLG/", 
            "id": "TQNTFLG", 
            "database": "OMA"
        }, 
        {
            "url": "http://www.orthodb.org/?query=1318335at2759", 
            "id": "1318335at2759", 
            "database": "OrthoDB"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF00096", 
            "id": "PF00096", 
            "database": "Pfam"
        }, 
        {
            "url": "http://purl.obolibrary.org/obo/PR_PR_A2AJ77", 
            "id": "PR_A2AJ77", 
            "database": "PRO"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834", 
            "id": "NP_001116834", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001116834.1", 
            "id": "NP_001116834.1", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AJ77", 
            "id": "A2AJ77", 
            "database": "UniProtKB"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AJ77-1", 
            "id": "A2AJ77-1", 
            "database": "UniProtKB"
        }
    ], 
    "expression_disease": [], 
    "glycosylation": [], 
    "mutagenesis": [], 
    "disease": [
        {
            "disease_id": "DOID:0070153", 
            "synonyms": [
                {
                    "url": "http://disease-ontology.org/term/DOID:0070153", 
                    "resource": "Disease Ontology", 
                    "description": "", 
                    "name": "hereditary sensory and autonomic neuropathy type VIII", 
                    "id": "DOID:0070153"
                }, 
                {
                    "url": "http://disease-ontology.org/term/DOID:0070153", 
                    "resource": "Disease Ontology", 
                    "description": "", 
                    "name": "HSAN8", 
                    "id": "DOID:0070153"
                }, 
                {
                    "url": "https://monarchinitiative.org/disease/MONDO:0014662", 
                    "resource": "MONDO", 
                    "description": "A hereditary sensory neuropathy characterized by congenital insensitivity to pain and decreased sweating and tear production that has_material_basis_in homozygous mutation in the PRDM12 gene on chromosome 9q34.", 
                    "name": "congenital insensitivity to pain-hypohidrosis syndrome", 
                    "id": "MONDO:0014662"
                }, 
                {
                    "url": "https://monarchinitiative.org/disease/MONDO:0014662", 
                    "resource": "MONDO", 
                    "description": "", 
                    "name": "HSAN 8", 
                    "id": "MONDO:0014662"
                }, 
                {
                    "url": "https://monarchinitiative.org/disease/MONDO:0014662", 
                    "resource": "MONDO", 
                    "description": "", 
                    "name": "neuropathy, hereditary sensory and autonomic, type 8", 
                    "id": "MONDO:0014662"
                }, 
                {
                    "url": "https://monarchinitiative.org/disease/MONDO:0014662", 
                    "resource": "MONDO", 
                    "description": "", 
                    "name": "neuropathy, hereditary sensory and autonomic, type VIII; HSAN8", 
                    "id": "MONDO:0014662"
                }, 
                {
                    "url": "https://monarchinitiative.org/disease/MONDO:0014662", 
                    "resource": "MONDO", 
                    "description": "", 
                    "name": "hereditary sensory and autonomic neuropathy type 8", 
                    "id": "MONDO:0014662"
                }, 
                {
                    "url": "https://monarchinitiative.org/disease/MONDO:0014662", 
                    "resource": "MONDO", 
                    "description": "", 
                    "name": "hereditary sensory and autonomic neuropathy type VIII", 
                    "id": "MONDO:0014662"
                }, 
                {
                    "url": "https://monarchinitiative.org/disease/MONDO:0014662", 
                    "resource": "MONDO", 
                    "description": "", 
                    "name": "HSAN8", 
                    "id": "MONDO:0014662"
                }, 
                {
                    "url": "https://monarchinitiative.org/disease/MONDO:0014662", 
                    "resource": "MONDO", 
                    "description": "", 
                    "name": "CIP-hypohidrosis syndrome", 
                    "id": "MONDO:0014662"
                }, 
                {
                    "url": "https://monarchinitiative.org/disease/MONDO:0014662", 
                    "resource": "MONDO", 
                    "description": "", 
                    "name": "neuropathy, hereditary sensory and autonomic, type VIII", 
                    "id": "MONDO:0014662"
                }, 
                {
                    "url": "https://www.omim.org/entry/616488", 
                    "resource": "MIM", 
                    "description": "Neuropathy, hereditary sensory and autonomic, 8", 
                    "name": "Neuropathy, hereditary sensory and autonomic, 8", 
                    "id": "MIM:616488"
                }
            ], 
            "recommended_name": {
                "url": "http://disease-ontology.org/term/DOID:0070153", 
                "resource": "Disease Ontology", 
                "description": "A hereditary sensory neuropathy characterized by congenital insensitivity to pain and decreased sweating and tear production that has_material_basis_in homozygous mutation in the PRDM12 gene on chromosome 9q34.", 
                "name": "hereditary sensory and autonomic neuropathy type 8", 
                "id": "DOID:0070153"
            }, 
            "evidence": [
                {
                    "url": "https://www.alliancegenome.org/gene/0070153#disease-associations", 
                    "id": "0070153", 
                    "database": "Alliance of Genome Resources"
                }
            ]
        }
    ], 
    "phosphorylation": [], 
    "mass": {
        "monoisotopic_mass": 40303.0, 
        "chemical_mass": 40303.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A2AJ77", 
            "name": "Prdm12", 
            "locus": {
                "end_pos": 31655795, 
                "strand": "+", 
                "start_pos": 31640037, 
                "chromosome": "2", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSG00000079466", 
                        "id": "ENSMUSG00000079466", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ], 
    "protein_names": [
        {
            "url": "https://www.uniprot.org/uniprot/A2AJ77#names_and_taxonomy", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "2.1.1.-"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2AJ77", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "PR domain zinc finger protein 12"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AJ77#names_and_taxonomy", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "PR domain zinc finger protein 12"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2AJ77", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "PR domain-containing protein 12"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AJ77#names_and_taxonomy", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "PR domain-containing protein 12"
        }
    ]
}