{ "uniprot_canonical_ac": "A0A0G2KBA5-1", "ptm_annotation": [], "sequence": { "header": "tr|A0A0G2KBA5-1|A0A0G2KBA5_RAT Isoform 1 of Purkinje cell protein 4-like 1 OS=Rattus norvegicus OX=10116 GN=Pcp4l1 PE=1 SV=1 CANONICAL=A0A0G2KBA5-1", "length": 68, "sequence": "MSSLNTKTPPATSQASDPEEKGKPGSIKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDSSS" }, "uniprot_id": "A0A0G2KBA5_RAT", "glycation": [], "keywords": [], "species": [ { "common_name": "Rat", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KBA5", "id": "A0A0G2KBA5", "database": "UniProtKB" } ], "name": "Rattus norvegicus", "taxid": 10116 } ], "reaction_enzymes": [], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/12477932", "type": "PubMed", "id": "12477932" } ], "title": "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119565.1", "id": "NP_001119565.1", "database": "RefSeq" } ], "authors": "Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA", "date": "2002" } ], "uniprot_ac": "A0A0G2KBA5", "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A0A0G2KBA5", "type": "synonym", "resource": "RefSeq", "name": "Pcp4l1" }, { "url": "https://www.uniprot.org/uniprot/A0A0G2KBA5", "type": "recommended", "resource": "UniProtKB", "name": "Pcp4l1" }, { "url": "https://www.uniprot.org/uniprot/A0A0G2KBA5", "type": "synonym", "resource": "UniProtKB", "name": "rCG_20116" } ], "reactions": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KBA5#A0A0G2KBA5-1", "isoform_ac": "A0A0G2KBA5-1", "locus": { "end_pos": 89543512, "strand": "+", "start_pos": 89545182, "chromosome": "13", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000078402", "id": "ENSRNOT00000078402", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000075716", "id": "ENSRNOP00000075716", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A0G2KBA5-1|A0A0G2KBA5_RAT Isoform 1 of Purkinje cell protein 4-like 1 OS=Rattus norvegicus OX=10116 GN=Pcp4l1 PE=1 SV=1 CANONICAL=A0A0G2KBA5-1", "length": 68, "sequence": "MSSLNTKTPPATSQASDPEEKGKPGSIKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDSSS" } }, { "url": "https://www.uniprot.org/uniprot/A0A0G2KBA5#B1WC83-1", "isoform_ac": "B1WC83-1", "locus": { "end_pos": 89543512, "strand": "+", "start_pos": 89565624, "chromosome": "13", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000004347", "id": "ENSRNOT00000004347", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000004347", "id": "ENSRNOP00000004347", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|B1WC83-1|B1WC83_RAT Computationally mapped isoform of Pcp4l1 protein OS=Rattus norvegicus OX=10116 GN=Pcp4l1 PE=1 SV=1 CANONICAL=A0A0G2KBA5-1", "length": 68, "sequence": "MSELNTKTPPATSQASDPEEKGKPGSIKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDSSS" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:685448", "resource": "KEGG Pathway", "id": "rno:685448", "name": "" } ], "reaction_participants": [], "function": [], "orthologs": [ { "uniprot_canonical_ac": "A6NKN8-1", "protein_name": "Purkinje cell protein 4-like protein 1", "sequence": { "length": 68, "sequence": "MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A0A0G2KBA5/", "id": "A0A0G2KBA5", "database": "OMA" } ], "common_name": "Human", "organism": "Homo sapiens", "gene_name": "PCP4L1", "tax_id": 9606 }, { "uniprot_canonical_ac": "Q6W8Q3-1", "protein_name": "Purkinje cell protein 4-like protein 1", "sequence": { "length": 68, "sequence": "MSELNTKTPPAANQASDPEEKGKPGSIKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDSSS" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/136091", "id": "136091", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A0A0G2KBA5/", "id": "A0A0G2KBA5", "database": "OMA" } ], "common_name": "Mouse", "organism": "Mus musculus", "gene_name": "Pcp4l1", "tax_id": 10090 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119565.1", "ac": "NP_001119565.1", "name": "Purkinje cell protein 4-like protein 1", "summary": "" }, "go_annotation": {}, "site_annotation": [], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000003209", "id": "ENSRNOG00000003209", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/685448", "id": "685448", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000048", "id": "IPR000048", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR033234", "id": "IPR033234", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:685448", "id": "rno:685448", "database": "KEGG Pathway" }, { "url": "https://omabrowser.org/oma/group/PCEKASA/", "id": "PCEKASA", "database": "OMA" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15359:SF5", "id": "PTHR15359:SF5", "database": "PANTHER" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119565", "id": "NP_001119565", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001119565.1", "id": "NP_001119565.1", "database": "RefSeq" }, { "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1593809", "id": "1593809", "database": "RGD" }, { "url": "https://www.uniprot.org/uniprot/A0A0G2KBA5", "id": "A0A0G2KBA5", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A0A0G2KBA5-1", "id": "A0A0G2KBA5-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/B1WC83", "id": "B1WC83", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/B1WC83-1", "id": "B1WC83-1", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 7463.0, "chemical_mass": 7463.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KBA5", "name": "Pcp4l1", "locus": { "end_pos": 89542378, "strand": "-", "start_pos": 89565813, "chromosome": "13", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOG00000003209", "id": "ENSRNOG00000003209", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A0A0G2KBA5#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Pcp4l1 protein" }, { "url": "https://www.uniprot.org/uniprot/A0A0G2KBA5#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Purkinje cell protein 4-like 1" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A0A0G2KBA5", "type": "synonym", "resource": "RefSeq", "name": "Purkinje cell protein 4-like protein 1" }, { "url": "https://www.uniprot.org/uniprot/A0A0G2KBA5#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "RCG20116, isoform CRA_c" } ] }