{ "uniprot_canonical_ac": "A2RST1-1", "ptm_annotation": [], "sequence": { "header": "sp|A2RST1-1|MGST2_MOUSE Isoform 1 of Microsomal glutathione S-transferase 2 OS=Mus musculus OX=10090 GN=Mgst2 PE=2 SV=1 CANONICAL=A2RST1-1", "length": 147, "sequence": "MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAQQNSLEFYPVFIVMLWMAGWYFNQVFAACLGLLYIYARHKYFWGYAEAAEKRITGFRLSLGILTLLPVLAVLGVASRFLNEYLDFHVAKKLRKPF" }, "uniprot_id": "A0A0A6YWX7_MOUSE", "enzyme_annotation": [ { "ec": "1.11.1.-", "activity": "" }, { "ec": "2.5.1.18", "activity": "" }, { "ec": "2.5.1.18", "activity": "RX + glutathione = HX + R-S-glutathione." }, { "ec": "4.4.1.20", "activity": "Leukotriene C(4) = leukotriene A(4) + glutathione." } ], "glycation": [], "keywords": [ "enzyme" ], "species": [ { "common_name": "Mouse", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008047", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "enzyme activator activity", "id": "GO:0008047" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004364", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "glutathione transferase activity", "id": "GO:0004364" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043295", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "glutathione binding", "id": "GO:0043295" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004464", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "leukotriene-C4 synthase activity", "id": "GO:0004464" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "identical protein binding", "id": "GO:0042802" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004602", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "glutathione peroxidase activity", "id": "GO:0004602" } ], "total": 6, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "integral component of membrane", "id": "GO:0016021" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "endoplasmic reticulum membrane", "id": "GO:0005789" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005635", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "nuclear envelope", "id": "GO:0005635" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "endoplasmic reticulum", "id": "GO:0005783" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "plasma membrane", "id": "GO:0005886" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "membrane", "id": "GO:0016020" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "intracellular membrane-bounded organelle", "id": "GO:0043231" } ], "total": 8, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019370", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "leukotriene biosynthetic process", "id": "GO:0019370" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006750", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "glutathione biosynthetic process", "id": "GO:0006750" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "lipid metabolic process", "id": "GO:0006629" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046466", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "name": "membrane lipid catabolic process", "id": "GO:0046466" } ], "total": 4, "name": "Biological Process" } ] }, "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/26656251", "type": "PubMed", "id": "26656251" } ], "title": "Leukotriene C4 is the major trigger of stress-induced oxidative DNA damage.", "journal": "Nat. Commun.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" } ], "authors": "Rubinstein M., Barak S., Dvash E., Har-Tal M., Meir O.", "date": "2015" } ], "uniprot_ac": "A2RST1", "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RST1", "type": "synonym", "resource": "RefSeq", "name": "GST; GST2; MGST; MGST-II" }, { "url": "https://www.uniprot.org/uniprot/A2RST1", "type": "synonym", "resource": "UniProtKB", "name": "Gst2" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RST1", "type": "synonym", "resource": "RefSeq", "name": "Mgst2" }, { "url": "https://www.uniprot.org/uniprot/A2RST1", "type": "recommended", "resource": "UniProtKB", "name": "Mgst2" } ], "reactions": [ { "source": "Reactome", "output_participant_list": [], "name": "GST trimers transfer GS from GSH to luminal substrates", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-176059", "cellular_location": "plasma membrane", "input_participant_list": [], "enzyme_list": [ "Q9CPU4-1", "Q91VS7-1", "A2RST1-1" ], "id": "R-MMU-176059", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp" }, { "source": "Reactome", "output_participant_list": [], "name": "MGST trimers transfer GS from GSH to AFXBO and AFNBO", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5423653", "cellular_location": "plasma membrane", "input_participant_list": [], "enzyme_list": [ "Q9CPU4-1", "Q91VS7-1", "A2RST1-1" ], "id": "R-MMU-5423653", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp" } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2RST1#A0A0A6YWX7-1", "isoform_ac": "A0A0A6YWX7-1", "locus": { "end_pos": 51661249, "strand": "-", "start_pos": 51682470, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000159554", "id": "ENSMUST00000159554", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000141745", "id": "ENSMUSP00000141745", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A0A6YWX7-1|MGST2_MOUSE Computationally mapped isoform of Microsomal glutathione S-transferase 2 OS=Mus musculus OX=10090 GN=Mgst2 PE=2 SV=1 CANONICAL=A2RST1-1", "length": 82, "sequence": "MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAQQNSLEFYPVFIVMLWMAGWYFNQGSPVSD" } }, { "url": "https://www.uniprot.org/uniprot/A2RST1#A2RST1-1", "isoform_ac": "A2RST1-1", "locus": { "end_pos": 51661249, "strand": "-", "start_pos": 51682583, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000099106", "id": "ENSMUST00000099106", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000096705", "id": "ENSMUSP00000096705", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A2RST1-1|MGST2_MOUSE Isoform 1 of Microsomal glutathione S-transferase 2 OS=Mus musculus OX=10090 GN=Mgst2 PE=2 SV=1 CANONICAL=A2RST1-1", "length": 147, "sequence": "MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAQQNSLEFYPVFIVMLWMAGWYFNQVFAACLGLLYIYARHKYFWGYAEAAEKRITGFRLSLGILTLLPVLAVLGVASRFLNEYLDFHVAKKLRKPF" } }, { "url": "https://www.uniprot.org/uniprot/A2RST1#E0CZ62-1", "isoform_ac": "E0CZ62-1", "locus": { "end_pos": 51661249, "strand": "-", "start_pos": 51681869, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000161590", "id": "ENSMUST00000161590", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000125670", "id": "ENSMUSP00000125670", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|E0CZ62-1|E0CZ62_MOUSE Computationally mapped isoform of Microsomal glutathione S-transferase 2 OS=Mus musculus OX=10090 GN=Mgst2 PE=1 SV=1 CANONICAL=A2RST1-1", "length": 77, "sequence": "MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAHFCSLSGSPVHIRPSQVFLGLCRSR" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:211666", "resource": "KEGG Pathway", "id": "mmu:211666", "name": "" }, { "reaction_list": [ "R-MMU-176054", "R-MMU-176059", "R-MMU-3301943", "R-MMU-5692232", "R-MMU-5693724" ], "resource": "Reactome", "description": "Glutathione conjugation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-156590", "id": "R-MMU-156590", "name": "Glutathione conjugation" }, { "reaction_list": [ "R-MMU-156526", "R-MMU-5423637", "R-MMU-5423647", "R-MMU-5423653", "R-MMU-5423664", "R-MMU-5423672", "R-MMU-5433067", "R-MMU-5433072", "R-MMU-5433074", "R-MMU-9638046" ], "resource": "Reactome", "description": "Aflatoxin activation and detoxification", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5423646", "id": "R-MMU-5423646", "name": "Aflatoxin activation and detoxification" } ], "reaction_participants": [], "function": [ { "url": "https://www.uniprot.org/uniprot/A2RST1#function", "annotation": "Catalyzes several different glutathione-dependent reactions. Catalyzes the glutathione-dependent reduction of lipid hydroperoxides, such as 5-HPETE. Has glutathione transferase activity, toward xenobiotic electrophiles, such as 1-chloro-2, 4-dinitrobenzene (CDNB). Catalyzes also the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4 (LTC4) (By similarity). Involved in oxidative DNA damage induced by ER stress and anticancer agents by activating LTC4 biosynthetic machinery in nonimmune cells (PubMed:26656251).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RST1#function", "id": "A2RST1", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2JU12-1", "protein_name": "Microsomal glutathione S-transferase 2", "sequence": { "length": 128, "sequence": "GYFALQVGRVRLKYKIAPPAVTGSLEFERIFRAQQNSLEFYSVFIISLWMAGWYFNQVFATCLGLLYIYARHKYFWGYAEAAEKRIIGFRLSLGILALLTVLAVLGVASRFLDEYLDFHVAKKLKRPF" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A2RST1/", "id": "A2RST1", "database": "OMA" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "gene_name": "Mgst2", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q99735-1", "protein_name": "Microsomal glutathione S-transferase 2", "sequence": { "length": 147, "sequence": "MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTLLGALGIANSFLDEYLDLNIAKKLRRQF" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/1811", "id": "1811", "database": "MGI" } ], "common_name": "Human", "organism": "Homo sapiens", "gene_name": "MGST2", "tax_id": 9606 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778160.2", "ac": "NP_778160.2", "name": "microsomal glutathione S-transferase 2 isoform 1", "summary": "" }, "reaction_enzymes": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "activity": "", "gene_name": "Mgst2", "uniprot_ac": "A2RST1", "ec_number": "2.5.1.18" }, { "url": "https://www.uniprot.org/uniprot/Q91VS7", "activity": "", "gene_name": "Mgst1", "uniprot_ac": "Q91VS7", "ec_number": "2.5.1.18" }, { "url": "https://www.uniprot.org/uniprot/Q9CPU4", "activity": "", "gene_name": "Mgst3", "uniprot_ac": "Q9CPU4", "ec_number": "1.11.1.-" } ], "site_annotation": [], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000074604", "id": "ENSMUSG00000074604", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/211666", "id": "211666", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR001129", "id": "IPR001129", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR001446", "id": "IPR001446", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR023352", "id": "IPR023352", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:211666", "id": "mmu:211666", "database": "KEGG Pathway" }, { "url": "http://www.informatics.jax.org/marker/MGI:2448481", "id": "2448481", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/HKYFWGY/", "id": "HKYFWGY", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1609516at2759", "id": "1609516at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF01124", "id": "PF01124", "database": "Pfam" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-156590", "id": "R-MMU-156590", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5423646", "id": "R-MMU-5423646", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297411", "id": "NP_001297411", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001297411.1", "id": "NP_001297411.1", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778160", "id": "NP_778160", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_778160.2", "id": "NP_778160.2", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A0A0A6YWX7", "id": "A0A0A6YWX7", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A0A0A6YWX7-1", "id": "A0A0A6YWX7-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A2RST1", "id": "A2RST1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A2RST1-1", "id": "A2RST1-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/E0CZ62", "id": "E0CZ62", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/E0CZ62-1", "id": "E0CZ62-1", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 16786.0, "chemical_mass": 16786.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2RST1", "name": "Mgst2", "locus": { "end_pos": 51682677, "strand": "+", "start_pos": 51660360, "chromosome": "3", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000074604", "id": "ENSMUSG00000074604", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "1.11.1.-" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "2.5.1.18" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "4.4.1.20" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Glutathione peroxidase MGST2" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Leukotriene C4 synthase MGST2" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Microsomal GST-2" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Microsomal GST-II" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Microsomal glutathione S-transferase 2" }, { "url": "https://www.uniprot.org/uniprot/A2RST1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Microsomal glutathione S-transferase II" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RST1", "type": "synonym", "resource": "RefSeq", "name": "microsomal GST-2; microsomal GST-II; glutathione peroxidase MGST2; leukotriene C4 synthase MGST2; microsomal glutathione S-transferase II" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RST1", "type": "synonym", "resource": "RefSeq", "name": "microsomal glutathione S-transferase 2 isoform 1" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RST1", "type": "synonym", "resource": "RefSeq", "name": "microsomal glutathione S-transferase 2 isoform 2" } ] }