The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.
More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp" } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2AKM2#A2AKM2-1", "isoform_ac": "A2AKM2-1", "locus": { "end_pos": 88414267, "strand": "+", "start_pos": 88438870, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000030221", "id": "ENSMUST00000030221", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000030221", "id": "ENSMUSP00000030221", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A2AKM2-1|HACD4_MOUSE Isoform 1 of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 OS=Mus musculus OX=10090 GN=Hacd4 PE=2 SV=2 CANONICAL=A2AKM2-1", "length": 232, "sequence": "MGPSVLPAWLQPRYRKNVYLFIYYLIQFCGHSWILANMTVRFFSFGKDSMADTFYAIGLVMRVCQSISLLELLHIYIGIESNQLFPRFLQLTERVIILFGVITSQEEVQEKCVVCVLFILWNLLDMVRYTYSMLSVIGTSYAALTWLSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTNSTVLPFDLSTCFPYVLKLYLMMLFIGMYFTYSHLYTERKDFLRVFSVKQKNV" } }, { "url": "https://www.uniprot.org/uniprot/A2AKM2#A2AKM2-2", "isoform_ac": "A2AKM2-2", "locus": {}, "sequence": { "header": "sp|A2AKM2-2|HACD4_MOUSE Isoform 2 of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 OS=Mus musculus OX=10090 GN=Hacd4 PE=2 SV=2 CANONICAL=A2AKM2-1", "length": 247, "sequence": "MGPSVLPAWLQPRYRKNVYLFIYYLIQFCGHSWILANMTVRFFSFGKDSMADTFYAIGLVMRVCQSISLLELLHIYIGIESNQLFPRFLQLTERVIILFGVITSQEEVQEKCVVCVLFILWNLLDMVRYTYSMLSVIGTSYAALTWLSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTNSTVLPFDLSTCFPYVLKLYLMMLFIGNAKMFLIKCKKLCLKVFHSPIHLLHVLNTGHTTRPTTRPDI" } }, { "url": "https://www.uniprot.org/uniprot/A2AKM2#F7CPS1-1", "isoform_ac": "F7CPS1-1", "locus": { "end_pos": 88414265, "strand": "+", "start_pos": 88438928, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000151280", "id": "ENSMUST00000151280", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000122565", "id": "ENSMUSP00000122565", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|F7CPS1-1|HACD4_MOUSE Computationally mapped isoform of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 OS=Mus musculus OX=10090 GN=Hacd4 PE=2 SV=1 CANONICAL=A2AKM2-1", "length": 252, "sequence": "XLSQPTPAASRRCQRSRLWPMGPSVLPAWLQPRYRKNVYLFIYYLIQFCGHSWILANMTVRFFSFGKDSMADTFYAIGLVMRVCQSISLLELLHIYIGIESNQLFPRFLQLTERVIILFGVITSQEEVQEKCVVCVLFILWNLLDMVRYTYSMLSVIGTSYAALTWLSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTNSTVLPFDLSTCFPYVLKLYLMMLFIGMYFTYSHLYTERKDFLRVFSVKQKNV" } }, { "url": "https://www.uniprot.org/uniprot/A2AKM2#Z4YMP4-1", "isoform_ac": "Z4YMP4-1", "locus": { "end_pos": 88398095, "strand": "+", "start_pos": 88438915, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000132493", "id": "ENSMUST00000132493", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000119411", "id": "ENSMUSP00000119411", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|Z4YMP4-1|HACD4_MOUSE Computationally mapped isoform of Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 OS=Mus musculus OX=10090 GN=Hacd4 PE=2 SV=1 CANONICAL=A2AKM2-1", "length": 262, "sequence": "TPAASRRCQRSRLWPMGPSVLPAWLQPRYRKNVYLFIYYLIQFCGHSWILANMTVRFFSFGKDSMADTFYAIGLVMRVCQSISLLELLHIYIGIESNQLFPRFLQLTERVIILFGVITSQEEVQEKCVVCVLFILWNLLDMVRYTYSMLSVIGTSYAALTWLSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTNSTVLPFDLSTCFPYVLKLYLMMLFIGNAKMFLIKCKKLCLKVFHSPIHLLHVLNTGHTTRPTTRPDI" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66775", "resource": "KEGG Pathway", "id": "mmu:66775", "name": "" }, { "reaction_list": [ "R-MMU-201035", "R-MMU-548800", "R-MMU-548814", "R-MMU-548815", "R-MMU-548818", "R-MMU-548831", "R-MMU-548843", "R-MMU-5676637", "R-MMU-5695957", "R-MMU-5696007" ], "resource": "Reactome", "description": "Synthesis of very long-chain fatty acyl-CoAs", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-75876", "id": "R-MMU-75876", "name": "Synthesis of very long-chain fatty acyl-CoAs" } ], "reaction_participants": [ { "crossref": [ { "url": "", "id": "15456", "database": "ChEBI" }, { "url": "", "id": "C01086", "database": "COMPOUND" }, { "url": "", "id": "15456", "database": "ChEBI" }, { "url": "", "id": "C01086", "database": "COMPOUND" }, { "url": "", "id": "15456", "database": "ChEBI" }, { "url": "", "id": "C01086", "database": "COMPOUND" } ], "participant_name": "VLC3HA-CoA [cytosol]", "participant_id": "R-ALL-5676631" }, { "crossref": [ { "url": "", "id": "50998", "database": "ChEBI" }, { "url": "", "id": "C02609", "database": "COMPOUND" }, { "url": "", "id": "50998", "database": "ChEBI" }, { "url": "", "id": "C02609", "database": "COMPOUND" }, { "url": "", "id": "C02609", "database": "COMPOUND" }, { "url": "", "id": "50998", "database": "ChEBI" } ], "participant_name": "2,3-TE-CoA [cytosol]", "participant_id": "R-ALL-5676634" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A2AKM2#function", "annotation": "Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AKM2#function", "id": "A2AKM2", "database": "UniProtKB" } ] }, { "url": "https://www.uniprot.org/uniprot/F7CPS1#function", "annotation": "Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates to the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/F7CPS1#function", "id": "F7CPS1", "database": "UniProtKB" } ] }, { "url": "https://www.uniprot.org/uniprot/Z4YMP4#function", "annotation": "Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates to the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/Z4YMP4#function", "id": "Z4YMP4", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "D3Z8V6-1", "protein_name": "Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase", "sequence": { "length": 232, "sequence": "MGPSVLPAWLQPRYRKSAYLFIYYLIQFCGHSWILTNMTVRFFSFGKDSMVDTFYAIGLVMRVCQSISLLELLHIYIGIESNQLFPKFLQLTERIIILFGVITSQEEVQEKYVVCVLFIFWNLLDMVRYTYSMLSVIGTSYAVLTWLSQTLWMPIYPLCVLAEAFTIYQSLPYFELFGKNSTMLPFDISTYFPYVLKLYLMMLFIGMYFTYSHLYTERKDILRGSSVKQKKM" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A2AKM2/", "id": "A2AKM2", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/12033", "id": "12033", "database": "MGI" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "gene_name": "Hacd4", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q5VWC8-1", "protein_name": "Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4", "sequence": { "length": 232, "sequence": "MGPLALPAWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLVMRLCQSVSLLELLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFWNLLDMVRYTYSMLSVIGISYAVLTWLSQTLWMPIYPLCVLAEAFAIYQSLPYFESFGTYSTKLPFDLSIYFPYVLKIYLMMLFIGMYFTYSHLYSERRDILGIFPIKKKKM" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A2AKM2/", "id": "A2AKM2", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/12033", "id": "12033", "database": "MGI" } ], "common_name": "Human", "organism": "Homo sapiens", "gene_name": "HACD4", "tax_id": 9606 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080036.1", "ac": "NP_080036.1", "name": "very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 isoform a", "summary": "" }, "reaction_enzymes": [ { "url": "https://www.uniprot.org/uniprot/A2AKM2", "activity": "", "gene_name": "Hacd4", "uniprot_ac": "A2AKM2", "ec_number": "4.2.1.134" }, { "url": "https://www.uniprot.org/uniprot/Q8K2C9", "activity": "", "gene_name": "Hacd3", "uniprot_ac": "Q8K2C9", "ec_number": "4.2.1.134" }, { "url": "https://www.uniprot.org/uniprot/Q9D3B1", "activity": "", "gene_name": "Hacd2", "uniprot_ac": "Q9D3B1", "ec_number": "4.2.1.134" }, { "url": "https://www.uniprot.org/uniprot/Q9QY80", "activity": "", "gene_name": "Hacd1", "uniprot_ac": "Q9QY80", "ec_number": "4.2.1.134" } ], "site_annotation": [ { "end_pos": 182, "annotation": "n_glycosylation_sequon", "start_pos": 180 }, { "end_pos": 39, "annotation": "n_glycosylation_sequon", "start_pos": 37 } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000028497", "id": "ENSMUSG00000028497", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/66775", "id": "66775", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR007482", "id": "IPR007482", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66775", "id": "mmu:66775", "database": "KEGG Pathway" }, { "url": "http://www.informatics.jax.org/marker/MGI:1914025", "id": "1914025", "database": "MGI" }, { "url": "http://www.orthodb.org/?query=1458293at2759", "id": "1458293at2759", "database": "OrthoDB" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11035", "id": "PTHR11035", "database": "PANTHER" }, { "url": "http://pfam.xfam.org/family/PF04387", "id": "PF04387", "database": "Pfam" }, { "url": "http://purl.obolibrary.org/obo/PR_PR_A2AKM2", "id": "PR_A2AKM2", "database": "PRO" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-75876", "id": "R-MMU-75876", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080036", "id": "NP_080036", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080036.1", "id": "NP_080036.1", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A2AKM2", "id": "A2AKM2", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A2AKM2-1", "id": "A2AKM2-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A2AKM2-2", "id": "A2AKM2-2", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/F7CPS1", "id": "F7CPS1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/F7CPS1-1", "id": "F7CPS1-1", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/Z4YMP4", "id": "Z4YMP4", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/Z4YMP4-1", "id": "Z4YMP4-1", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 27235.0, "chemical_mass": 27235.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2AKM2", "name": "Hacd4", "locus": { "end_pos": 88396144, "strand": "-", "start_pos": 88438928, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000028497", "id": "ENSMUSG00000028497", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A2AKM2#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "3-hydroxyacyl-CoA dehydratase 4" }, { "url": "https://www.uniprot.org/uniprot/A2AKM2#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "4.2.1.134" }, { "url": "https://www.uniprot.org/uniprot/A2AKM2#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "HACD4" }, { "url": "https://www.uniprot.org/uniprot/A2AKM2#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Protein-tyrosine phosphatase-like A domain-containing protein 2" }, { "url": "https://www.uniprot.org/uniprot/A2AKM2#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4" }, { "url": "https://www.uniprot.org/uniprot/A2AKM2#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AKM2", "type": "synonym", "resource": "RefSeq", "name": "protein tyrosine phosphatase-like A domain containing 2; protein-tyrosine phosphatase-like A domain-containing protein 2; protein tyrosine phosphatase-like protein PTPLAD2; very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 4; very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AKM2", "type": "synonym", "resource": "RefSeq", "name": "very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 isoform a" } ] }