{ "uniprot_canonical_ac": "A2AS89-1", "ptm_annotation": [], "sequence": { "header": "sp|A2AS89-1|SPEB_MOUSE Isoform 1 of Agmatinase, mitochondrial OS=Mus musculus OX=10090 GN=Agmat PE=1 SV=1 CANONICAL=A2AS89-1", "length": 358, "sequence": "MLRLLRSSWARGLGSGVATWRPSAGLFRPGCPGIRQASGASDTPHHQSPSSESPVQPVGVGVCSMMRLPLQSSPEGLDAAFIGVPLDTGTSNRPGARFGPCRIREESLMLGAVNPSTGALPFQSLRVADLGNVNVNLYNLQDSCLLIREAYQNVLAAGCIPLTLGGDQTITYPILQAVAKEHGPVGLVHVGAHTNTTDKPREEKVYHRTPFRRSVDEGLLDSKRVVQIGIRGSSRTLDPYRYSRSQGFRVVLAEDCWMKSLVPLMAEVRQQMGGKPLYISFAIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV" }, "uniprot_id": "SPEB_MOUSE", "glycation": [], "keywords": [], "species": [ { "common_name": "Mouse", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AS89", "id": "A2AS89", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "reaction_enzymes": [ { "gene_name": "Agmat", "uniprot_ac": "A2AS89", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AS89", "id": "A2AS89", "database": "UniProtKB" } ], "ec_number": "3.5.3.11", "activity": "Agmatine + H(2)O = putrescine + urea." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AS89", "id": "A2AS89", "database": "UniProtKB" } ], "ec_number": "3.5.3.11", "activity": "" } ] }, { "gene_name": "Agmat", "uniprot_ac": "Q0D2L3", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q0D2L3", "id": "Q0D2L3", "database": "UniProtKB" } ], "ec_number": "3.5.3.11", "activity": "Agmatine + H(2)O = putrescine + urea." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q0D2L3", "id": "Q0D2L3", "database": "UniProtKB" } ], "ec_number": "3.5.3.11", "activity": "" } ] }, { "gene_name": "AGMAT", "uniprot_ac": "Q9BSE5", "activity": [ { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9BSE5", "id": "Q9BSE5", "database": "UniProtKB" } ], "ec_number": "3.5.3.11", "activity": "Agmatine + H(2)O = putrescine + urea." }, { "evidence": [ { "url": "https://www.uniprot.org/uniprot/Q9BSE5", "id": "Q9BSE5", "database": "UniProtKB" } ], "ec_number": "3.5.3.11", "activity": "" } ] } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/11914032", "type": "PubMed", "id": "11914032" } ], "title": "Cloning and characterization of human agmatinase.", "journal": "Mol. Genet. Metab.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AS89", "id": "A2AS89", "database": "UniProtKB" } ], "authors": "Cederbaum S.D., Kim H.K., Grody W.W., Iyer R.K., Tsoa R.W.", "date": "2002" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/15028567", "type": "PubMed", "id": "15028567" } ], "title": "Vertebrate agmatinases: what role do they play in agmatine catabolism?", "journal": "Ann. N. Y. Acad. Sci.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AS89", "id": "A2AS89", "database": "UniProtKB" } ], "authors": "Morris S.M. Jr.", "date": "2003" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21386911", "type": "PubMed", "id": "21386911" } ], "title": "Identification of anchor genes during kidney development defines ontological relationships, molecular subcompartments and regulatory pathways.", "journal": "PloS one", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074877.1", "id": "NP_001074877.1", "database": "RefSeq" } ], "authors": "Thiagarajan RD, Georgas KM, Rumballe BA, Lesieur E, Chiu HS, Taylor D, Tang DT, Grimmond SM, Little MH", "date": "2011" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/23576753", "type": "PubMed", "id": "23576753" } ], "title": "Label-free quantitative proteomics of the lysine acetylome in mitochondria identifies substrates of SIRT3 in metabolic pathways.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AS89", "id": "A2AS89", "database": "UniProtKB" } ], "authors": "Verdin E., Gibson B.W., Rardin M.J., Schilling B., Li B., Kahn C.R., Mooney S.D., Newman J.C., Held J.M., Cusack M.P., Sorensen D.J.", "date": "2013" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/23806337", "type": "PubMed", "id": "23806337" } ], "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AS89", "id": "A2AS89", "database": "UniProtKB" } ], "authors": "Chen Y., Park J., Zhang Y., Zhao Y., Peng C., Tan M., Xie Z., Zwaans B.M., Lombard D.B., Dai L., Tishkoff D.X., Skinner M.E.", "date": "2013" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27404284", "type": "PubMed", "id": "27404284" } ], "title": "Involvement of the agmatinergic system in the depressive-like phenotype of the Crtc1 knockout mouse model of depression.", "journal": "Translational psychiatry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074877.1", "id": "NP_001074877.1", "database": "RefSeq" } ], "authors": "Meylan EM, Breuillaud L, Seredenina T, Magistretti PJ, Halfon O, Luthi-Carter R, Cardinaux JR", "date": "2016" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27846445", "type": "PubMed", "id": "27846445" } ], "title": "Mammalian agmatinases constitute unusual members in the family of Mn(2+)-dependent ureahydrolases.", "journal": "Journal of inorganic biochemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074877.1", "id": "NP_001074877.1", "database": "RefSeq" } ], "authors": "Romero N, Benitez J, Garcia D, Gonzalez A, Bennun L, Garcia-Robles MA, Lopez V, Wilson LA, Schenk G, Carvajal N, Uribe E", "date": "2017" } ], "uniprot_ac": "A2AS89", "gene_names": [ { "url": "https://www.uniprot.org/uniprot/A2AS89", "type": "recommended", "resource": "UniProtKB", "name": "Agmat" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AS89", "type": "synonym", "resource": "RefSeq", "name": "5033405N08Rik" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AS89", "type": "synonym", "resource": "RefSeq", "name": "Agmat" } ], "reactions": [ { "output_participant_list": [], "evidence": [ { "url": "https://www.rhea-db.org/rhea/13929", "id": "13929", "database": "Rhea" } ], "name": "", "cellular_location": "", "equation": "agmatine + H2O = putrescine + urea", "input_participant_list": [], "enzyme_list": [ "Q0D2L3-1", "Q9BSE5-1", "A2AS89-1" ], "id": "13929", "summary": "" }, { "output_participant_list": [], "evidence": [ { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-350604", "id": "R-MMU-350604", "database": "Reactome" } ], "name": "Agmatine + H2O <=> putrescine + urea", "cellular_location": "plasma membrane", "equation": "", "input_participant_list": [], "enzyme_list": [ "A2AS89-1" ], "id": "R-MMU-350604", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp" } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2AS89#A2AS89-1", "isoform_ac": "A2AS89-1", "locus": { "end_pos": 141746810, "strand": "-", "start_pos": 141759068, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000038161", "id": "ENSMUST00000038161", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000040853", "id": "ENSMUSP00000040853", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A2AS89-1|SPEB_MOUSE Isoform 1 of Agmatinase, mitochondrial OS=Mus musculus OX=10090 GN=Agmat PE=1 SV=1 CANONICAL=A2AS89-1", "length": 358, "sequence": "MLRLLRSSWARGLGSGVATWRPSAGLFRPGCPGIRQASGASDTPHHQSPSSESPVQPVGVGVCSMMRLPLQSSPEGLDAAFIGVPLDTGTSNRPGARFGPCRIREESLMLGAVNPSTGALPFQSLRVADLGNVNVNLYNLQDSCLLIREAYQNVLAAGCIPLTLGGDQTITYPILQAVAKEHGPVGLVHVGAHTNTTDKPREEKVYHRTPFRRSVDEGLLDSKRVVQIGIRGSSRTLDPYRYSRSQGFRVVLAEDCWMKSLVPLMAEVRQQMGGKPLYISFAIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:75986", "resource": "KEGG Pathway", "id": "mmu:75986", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-351143", "description": "Agmatine biosynthesis", "resource": "Reactome", "id": "R-MMU-351143", "name": "Agmatine biosynthesis" } ], "reaction_participants": [], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074877.1", "annotation": "It thus appears that mammalian AGMs form a distinct group within the family of ureahydrolases that (i) either fold in a manner distinct from other members in this family, or (ii) require accessory proteins to bind Mn(2+) in a mechanism related to that observed for the Ni(2+)-dependent urease.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074877.1", "id": "NP_001074877.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074877.1", "annotation": "These findings implicate Agmat in the depressive-like phenotype of Crtc1(-/-) mice, refine current understanding of the agmatinergic system in the brain and highlight its putative role in major depression. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074877.1", "id": "NP_001074877.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q0D2L3-1", "protein_name": "Agmatinase, mitochondrial", "sequence": { "length": 353, "sequence": "MLQLLKSSWVRSAGSGVVTWRASAGLFCPGTRQASDTSDTLHHPSPSSESQVQPVRVCSMMHLPLQSSPEGLDAAFVGVPLDTGTSNRPGARFGPRRIREESLMLGTVNPSTGALPFQSLRVADLGNVNVNLYNLQDSCRLIREAYQNILATGCIPLTLGGDHTITYPILQAVAKEHGPVGLVHVGAHSNTSDKPLEDKVYHRTPFRRSVDEGLLDSKRVVQIGIRGSSRTLDPYRYSRSQGFRVVLAEDCWMKSLVPLMAEIRQQMGGVPLYISFAIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/99855", "id": "99855", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A2AS89/", "id": "A2AS89", "database": "OMA" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "gene_name": "Agmat", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q9BSE5-1", "protein_name": "Agmatinase, mitochondrial", "sequence": { "length": 352, "sequence": "MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/99855", "id": "99855", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A2AS89/", "id": "A2AS89", "database": "OMA" } ], "common_name": "Human", "organism": "Homo sapiens", "gene_name": "AGMAT", "tax_id": 9606 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074877.1", "ac": "NP_001074877.1", "name": "agmatinase, mitochondrial isoform 2 precursor", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008783", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AS89", "id": "A2AS89", "database": "UniProtKB" } ], "name": "agmatinase activity", "id": "GO:0008783" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AS89", "id": "A2AS89", "database": "UniProtKB" } ], "name": "metal ion binding", "id": "GO:0046872" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AS89", "id": "A2AS89", "database": "UniProtKB" } ], "name": "mitochondrion", "id": "GO:0005739" } ], "total": 1, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033389", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AS89", "id": "A2AS89", "database": "UniProtKB" } ], "name": "putrescine biosynthetic process from arginine, using agmatinase", "id": "GO:0033389" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008295", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AS89", "id": "A2AS89", "database": "UniProtKB" } ], "name": "spermidine biosynthetic process", "id": "GO:0008295" } ], "total": 2, "name": "Biological Process" } ] }, "site_annotation": [ { "end_pos": 197, "annotation": "n_glycosylation_sequon", "start_pos": 195 } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000040706", "id": "ENSMUSG00000040706", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/75986", "id": "75986", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR005925", "id": "IPR005925", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR006035", "id": "IPR006035", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR023696", "id": "IPR023696", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:75986", "id": "mmu:75986", "database": "KEGG Pathway" }, { "url": "http://www.informatics.jax.org/marker/MGI:1923236", "id": "1923236", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/DTYFGAE/", "id": "DTYFGAE", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=921352at2759", "id": "921352at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF00491", "id": "PF00491", "database": "Pfam" }, { "url": "http://purl.obolibrary.org/obo/PR_PR_A2AS89", "id": "PR_A2AS89", "database": "PRO" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-351143", "id": "R-MMU-351143", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074877", "id": "NP_001074877", "database": "RefSeq" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001074877.1", "id": "NP_001074877.1", "database": "RefSeq" }, { "url": "https://www.rhea-db.org/rhea/13929", "id": "13929", "database": "Rhea" }, { "url": "https://www.uniprot.org/uniprot/A2AS89", "id": "A2AS89", "database": "UniProtKB" }, { "url": "https://www.uniprot.org/uniprot/A2AS89-1", "id": "A2AS89-1", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 38255.0, "chemical_mass": 38255.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2AS89", "name": "Agmat", "locus": { "end_pos": 141759263, "strand": "+", "start_pos": 141746672, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000040706", "id": "ENSMUSG00000040706", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A2AS89#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "Agmatinase, mitochondrial" }, { "url": "https://www.uniprot.org/uniprot/A2AS89#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "3.5.3.11" }, { "url": "https://www.uniprot.org/uniprot/A2AS89#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "AUH" }, { "url": "https://www.uniprot.org/uniprot/A2AS89#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Agmatine ureohydrolase" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AS89", "type": "synonym", "resource": "RefSeq", "name": "agmatinase, mitochondrial isoform 2 precursor" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AS89", "type": "synonym", "resource": "RefSeq", "name": "agmatinase, mitochondrial; AUH" } ] }