{ "uniprot_canonical_ac": "A1L1K4-1", "ptm_annotation": [], "sequence": { "header": "sp|A1L1K4-1|C42S2_RAT Isoform 1 of CDC42 small effector protein 2 OS=Rattus norvegicus OX=10116 GN=Cdc42se2 PE=3 SV=2 CANONICAL=A1L1K4-1", "length": 83, "sequence": "MSEFWLCFNCCIAEQPQPRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG" }, "uniprot_id": "C42S2_RAT", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Rat", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "id": "A1L1K4", "database": "UniProtKB" } ], "name": "Rattus norvegicus", "taxid": 10116 } ], "publication": [], "uniprot_ac": "A1L1K4", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4#A1L1K4-1", "isoform_ac": "A1L1K4-1", "locus": {}, "sequence": { "header": "sp|A1L1K4-1|C42S2_RAT Isoform 1 of CDC42 small effector protein 2 OS=Rattus norvegicus OX=10116 GN=Cdc42se2 PE=3 SV=2 CANONICAL=A1L1K4-1", "length": 83, "sequence": "MSEFWLCFNCCIAEQPQPRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG" } }, { "url": "https://www.uniprot.org/uniprot/A1L1K4#V9GZ87-1", "isoform_ac": "V9GZ87-1", "locus": { "end_pos": 40057133, "strand": "+", "start_pos": 40075830, "chromosome": "10", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000063891", "id": "ENSRNOT00000063891", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000061001", "id": "ENSRNOP00000061001", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|V9GZ87-1|C42S2_RAT Computationally mapped isoform of CDC42 small effector protein 2 OS=Rattus norvegicus OX=10116 GN=Cdc42se2 PE=3 SV=1 CANONICAL=A1L1K4-1", "length": 84, "sequence": "MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG" } } ], "pathway": [], "function": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4#function", "annotation": "Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages (By similarity).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4#function", "id": "A1L1K4", "database": "UniProtKB" } ] } ], "orthologs": [], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "refseq": {}, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017048", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "id": "A1L1K4", "database": "UniProtKB" } ], "name": "Rho GTPase binding", "id": "GO:0017048" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035591", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "id": "A1L1K4", "database": "UniProtKB" } ], "name": "signaling adaptor activity", "id": "GO:0035591" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001891", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "id": "A1L1K4", "database": "UniProtKB" } ], "name": "phagocytic cup", "id": "GO:0001891" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "id": "A1L1K4", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "id": "A1L1K4", "database": "UniProtKB" } ], "name": "cytoskeleton", "id": "GO:0005856" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "id": "A1L1K4", "database": "UniProtKB" } ], "name": "plasma membrane", "id": "GO:0005886" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042995", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "id": "A1L1K4", "database": "UniProtKB" } ], "name": "cell projection", "id": "GO:0042995" } ], "total": 5, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006909", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "id": "A1L1K4", "database": "UniProtKB" } ], "name": "phagocytosis", "id": "GO:0006909" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035023", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "id": "A1L1K4", "database": "UniProtKB" } ], "name": "regulation of Rho protein signal transduction", "id": "GO:0035023" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008360", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "id": "A1L1K4", "database": "UniProtKB" } ], "name": "regulation of cell shape", "id": "GO:0008360" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009966", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "id": "A1L1K4", "database": "UniProtKB" } ], "name": "regulation of signal transduction", "id": "GO:0009966" } ], "total": 4, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "type": "recommended", "resource": "UniProtKB", "name": "Cdc42se2" } ], "pro_annotation": [], "crossref": [ { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000095", "id": "IPR000095", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036936", "id": "IPR036936", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR039056", "id": "IPR039056", "database": "InterPro" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13502", "id": "PTHR13502", "database": "PANTHER" }, { "url": "http://pfam.xfam.org/family/PF00786", "id": "PF00786", "database": "Pfam" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A1L1K4", "id": "PR_A1L1K4", "database": "PRO" }, { "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1563924", "id": "1563924", "database": "RGD" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [ { "residue": "Ser", "kinase_gene_name": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "id": "A1L1K4", "database": "UniProtKB" } ], "start_pos": "42", "end_pos": "42", "kinase_uniprot_canonical_ac": "" }, { "residue": "Ser", "kinase_gene_name": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "id": "A1L1K4", "database": "UniProtKB" } ], "start_pos": "51", "end_pos": "51", "kinase_uniprot_canonical_ac": "" } ], "mass": { "monoisotopic_mass": 9095.0, "chemical_mass": 9095.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "name": "Cdc42se2", "locus": { "end_pos": 40054400, "strand": "-", "start_pos": 40122915, "chromosome": "10", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOG00000042449", "id": "ENSRNOG00000042449", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A1L1K4", "type": "recommended", "resource": "UniProtKB", "name": "CDC42 small effector protein 2" } ] }