{ "uniprot_canonical_ac": "A6NC86-1", "ptm_annotation": [], "sequence": { "header": "sp|A6NC86-1|PINLY_HUMAN Isoform 1 of phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein OS=Homo sapiens OX=9606 GN=PINLYP PE=2 SV=3 CANONICAL=A6NC86-1", "length": 204, "sequence": "MRLSRRPETFLLAFVLLCTLLGLGCPLHCEICTAAGSRCHGQMKTCSSDKDTCVLLVGKATSKGKELVHTYKGCIRSQDCYSGVISTTMGPKDHMVTSSFCCQSDGCNSAFLSVPLTNLTENGLMCPACTASFRDKCMGPMTHCTGKENHCVSLSGHVQAGIFKPRFAMRGCATESMCFTKPGAEVPTGTNVLFLHHIECTHSP" }, "uniprot_id": "PINLY_HUMAN", "enzyme_annotation": [], "glycation": [], "keywords": [ "glycoprotein", "reported_with_glycan.glygen_ds" ], "species": [ { "common_name": "Human", "taxid": 9606, "name": "Homo sapiens", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A6NC86", "id": "A6NC86", "database": "UniProtKB" } ] } ], "crossref_internal": { "gene": [ "PINLYP" ], "species": [ 9606 ], "disease": [ "DOID:263", "DOID:9256", "DOID:1781" ], "site": [ "A6NC86-1.203.203", "A6NC86-1.105.105", "A6NC86-1.64.64", "A6NC86-1.121.121", "A6NC86-1.118.120" ] }, "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/29351928", "type": [ "PubMed" ], "id": "29351928" } ], "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "evidence": [ { "url": "https://data.glygen.org/GLYDS000517", "id": "GLYDS000517", "database": "GlyGen" } ], "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "date": "2018" } ], "uniprot_ac": "A6NC86", "site_annotation": [ { "end_pos": 120, "annotation": "n_glycosylation_sequon", "start_pos": 118 } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A6NC86#A6NC86-1", "isoform_ac": "A6NC86-1", "sequence": { "header": "sp|A6NC86-1|PINLY_HUMAN Isoform 1 of phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein OS=Homo sapiens OX=9606 GN=PINLYP PE=2 SV=3 CANONICAL=A6NC86-1", "length": 204, "sequence": "MRLSRRPETFLLAFVLLCTLLGLGCPLHCEICTAAGSRCHGQMKTCSSDKDTCVLLVGKATSKGKELVHTYKGCIRSQDCYSGVISTTMGPKDHMVTSSFCCQSDGCNSAFLSVPLTNLTENGLMCPACTASFRDKCMGPMTHCTGKENHCVSLSGHVQAGIFKPRFAMRGCATESMCFTKPGAEVPTGTNVLFLHHIECTHSP" }, "locus": { "chromosome": "19", "end_pos": 43577192, "start_pos": 43581998, "strand": "-", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000599207", "id": "ENST00000599207", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000469886", "id": "ENSP00000469886", "database": "Ensembl Peptide" } ] } }, { "url": "https://www.uniprot.org/uniprot/A6NC86#A6NC86-2", "isoform_ac": "A6NC86-2", "sequence": { "header": "sp|A6NC86-2|PINLY_HUMAN Isoform 2 of phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein OS=Homo sapiens OX=9606 GN=PINLYP PE=2 SV=3 CANONICAL=A6NC86-1", "length": 228, "sequence": "MWVQTHPSSASYKSWGPGTADTHTMRLSRRPETFLLAFVLLCTLLGLGCPLHCEICTAAGSRCHGQMKTCSSDKDTCVLLVGKATSKGKELVHTYKGCIRSQDCYSGVISTTMGPKDHMVTSSFCCQSDGCNSAFLSVPLTNLTENGLMCPACTASFRDKCMGPMTHCTGKENHCVSLSGHVQAGIFKPRFAMRGCATESMCFTKPGAEVPTGTNVLFLHHIECTHSP" }, "locus": { "chromosome": "19", "end_pos": 43577120, "start_pos": 43581998, "strand": "-", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000612042", "id": "ENST00000612042", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000479240", "id": "ENSP00000479240", "database": "Ensembl Peptide" } ] } }, { "url": "https://www.uniprot.org/uniprot/A6NC86#A6NC86-3", "isoform_ac": "A6NC86-3", "sequence": { "header": "sp|A6NC86-3|PINLY_HUMAN Isoform 3 of phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein OS=Homo sapiens OX=9606 GN=PINLYP PE=2 SV=3 CANONICAL=A6NC86-1", "length": 143, "sequence": "MWVQTHPSSASYKSWGPGTADTHTMRLSRRPETFLLAFVLLCTLLGLGCPLHCEICTAAGSRCHGQMKTCSSDKDTCVLLVGKATSSKRMWPGTWWGGGVYLQGGRDYHAEGGSSRFSRRERGKKSVESRKEGKTIMRWREQK" }, "locus": {} }, { "url": "https://www.uniprot.org/uniprot/A6NC86#A6NC86-4", "isoform_ac": "A6NC86-4", "sequence": { "header": "sp|A6NC86-4|PINLY_HUMAN Isoform 4 of phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein OS=Homo sapiens OX=9606 GN=PINLYP PE=2 SV=3 CANONICAL=A6NC86-1", "length": 116, "sequence": "MGPKDHMVTSSFCCQSDGCNSAFLSVPLTNLTENGLMCPACTASFRDKCMGPMTHCTGKENHCVSLSGHVQAGIFKPRFAMRGCATESMCFTKPGAEVPTGTNVLFLHHIECTHSP" }, "locus": { "chromosome": "19", "end_pos": 43581289, "start_pos": 43581998, "strand": "-", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000569031", "id": "ENST00000569031", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000457369", "id": "ENSP00000457369", "database": "Ensembl Peptide" } ] } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:390940", "resource": "KEGG Pathway", "id": "hsa:390940", "name": "" } ], "function": [], "orthologs": [], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "D", "subjects_tested": "45", "alt_nt": "C", "chr_id": "19", "ref_nt": "G", "chr_pos": "44085489", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:263", "description": "", "resource": "Disease Ontology", "id": "DOID:263", "name": "malignant neoplasm of kidney except pelvis" }, { "url": "http://disease-ontology.org/term/DOID:263", "description": "", "resource": "Disease Ontology", "id": "DOID:263", "name": "malignant tumour of kidney" }, { "url": "http://disease-ontology.org/term/DOID:263", "description": "", "resource": "Disease Ontology", "id": "DOID:263", "name": "renal cancer" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:263", "description": "A urinary system cancer that is located_in the kidney.", "resource": "Disease Ontology", "id": "DOID:263", "name": "kidney cancer" } } ], "glycoeffect": [], "end_pos": 105, "frequency": "2.2", "sequence_mut": "H", "start_pos": 105, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A6NC86", "id": "A6NC86", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.2%)." }, { "sequence_org": "E", "subjects_tested": "94", "alt_nt": "T", "chr_id": "19", "ref_nt": "G", "chr_pos": "44085737", "disease": [ { "synonyms": [], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:9256", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "resource": "Disease Ontology", "id": "DOID:9256", "name": "colorectal cancer" } } ], "glycoeffect": [], "end_pos": 121, "frequency": "1.1", "sequence_mut": "D", "start_pos": 121, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A6NC86", "id": "A6NC86", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%)." }, { "sequence_org": "G", "subjects_tested": "50", "alt_nt": "A", "chr_id": "19", "ref_nt": "G", "chr_pos": "44085367", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "Thyroid gland neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant tumour of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid neoplasm" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1781", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage.", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid gland cancer" } } ], "glycoeffect": [], "end_pos": 64, "frequency": "2.0", "sequence_mut": "D", "start_pos": 64, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A6NC86", "id": "A6NC86", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%)." } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "refseq": {}, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004859", "pmid": "", "id": "GO:0004859", "name": "phospholipase inhibitor activity", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A6NC86", "id": "A6NC86", "database": "UniProtKB" } ] } ], "total": 1, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "pmid": "", "id": "GO:0005576", "name": "extracellular region", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A6NC86", "id": "A6NC86", "database": "UniProtKB" } ] } ], "total": 1, "name": "Cellular Component" } ] }, "gene_names": [ { "url": "https://www.uniprot.org/uniprot/A6NC86", "resource": "UniProtKB", "type": "recommended", "name": "PINLYP" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A6NC86", "id": "A6NC86", "database": "BioMuta" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PINLYP", "id": "PINLYP", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/390940", "id": "390940", "database": "GeneID" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=44206", "id": "44206", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR004126", "id": "IPR004126", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR016054", "id": "IPR016054", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:390940", "id": "hsa:390940", "database": "KEGG Pathway" }, { "url": "https://www.nextprot.org/entry/NX_A6NC86", "id": "NX_A6NC86", "database": "neXtProt" }, { "url": "https://omabrowser.org/oma/group/KFATRGC/", "id": "KFATRGC", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1485195at2759", "id": "1485195at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF00021", "id": "PF00021", "database": "Pfam" }, { "url": "http://pfam.xfam.org/family/PF02988", "id": "PF02988", "database": "Pfam" }, { "url": "https://pharos.nih.gov/targets/A6NC86", "id": "A6NC86", "database": "PHAROS" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A6NC86", "id": "PR_A6NC86", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001180550.1", "id": "NP_001180550.1", "database": "RefSeq" } ], "expression_disease": [], "glycosylation": [ { "residue": "Ser", "site_category": "reported_with_glycan", "evidence": [ { "url": "https://data.glygen.org/GLYDS000517", "id": "GLYDS000517", "database": "GlyGen" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/29351928", "id": "29351928", "database": "PubMed" } ], "subtype": "O-GlcNAcylation", "relation": "attached", "position": 203, "glytoucan_ac": "G49108TO", "type": "O-linked" } ], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 21926.0, "chemical_mass": 21926.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000234465", "id": "ENSG00000234465", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A6NC86", "name": "PINLYP", "locus": { "chromosome": "19", "end_pos": 43583964, "start_pos": 43576800, "strand": "+", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000234465", "id": "ENSG00000234465", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A6NC86", "resource": "RefSeq", "type": "synonym", "name": "phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein isoform 1 precursor" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A6NC86", "resource": "RefSeq", "type": "synonym", "name": "phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein" }, { "url": "https://www.uniprot.org/uniprot/A6NC86", "resource": "UniProtKB", "type": "recommended", "name": "phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein" } ] }