{ "uniprot_canonical_ac": "A6H8Z2-1", "ptm_annotation": [], "sequence": { "header": "sp|A6H8Z2-1|F221B_HUMAN Isoform 1 of Protein FAM221B OS=Homo sapiens OX=9606 GN=FAM221B PE=2 SV=2 CANONICAL=A6H8Z2-1", "length": 402, "sequence": "MEAHEIIEEPHITMDAEKHPPSKDPSAEDLQENHISESFLKPSTSETPLEPHTSESPLVPSPSQIPLEAHSPETHQEPSISETPSETPTYEASLDSPISVVPEKHLTLPPQSRDYVCLSSSDTLKEDLSSESSSNEVPWTRRSTHLSESESLPEHCLSGPSSQVQVDTTEKQEEEAGEVEKGVDASDSTAHTAQPGHQLGNTARPVFPARQTELVEVAKAMHREEFGAQVNNLFQWEKDAALNAIQTGLYIGWRCPHYLWDCFRIGDESRCFCGHLLREHRIISDISVPCKVSQCRCFMFCFIPSRPEEVGEFWLKRRATFDPKAWRAQCRCKHSHEEHAATGPHPCRHHGCCCGCFESNFLCAACDRRWEEHETFFDTQKTRQRGGRPRGTDTVSNWHRPL" }, "uniprot_id": "F221B_HUMAN", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Human", "taxid": 9606, "name": "Homo sapiens", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A6H8Z2", "id": "A6H8Z2", "database": "UniProtKB" } ] } ], "crossref_internal": { "gene": [ "FAM221B" ], "species": [ 9606 ], "disease": [ "DOID:1324", "DOID:11054", "DOID:263", "DOID:2531", "DOID:2394", "DOID:1781", "DOID:10283", "DOID:3907", "DOID:3571", "DOID:3910", "DOID:1319", "DOID:5041" ], "site": [ "A6H8Z2-1.199.199", "A6H8Z2-1.41.41", "A6H8Z2-1.369.369", "A6H8Z2-1.328.328" ] }, "publication": [], "uniprot_ac": "A6H8Z2", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A6H8Z2#A6H8Z2-1", "isoform_ac": "A6H8Z2-1", "sequence": { "header": "sp|A6H8Z2-1|F221B_HUMAN Isoform 1 of Protein FAM221B OS=Homo sapiens OX=9606 GN=FAM221B PE=2 SV=2 CANONICAL=A6H8Z2-1", "length": 402, "sequence": "MEAHEIIEEPHITMDAEKHPPSKDPSAEDLQENHISESFLKPSTSETPLEPHTSESPLVPSPSQIPLEAHSPETHQEPSISETPSETPTYEASLDSPISVVPEKHLTLPPQSRDYVCLSSSDTLKEDLSSESSSNEVPWTRRSTHLSESESLPEHCLSGPSSQVQVDTTEKQEEEAGEVEKGVDASDSTAHTAQPGHQLGNTARPVFPARQTELVEVAKAMHREEFGAQVNNLFQWEKDAALNAIQTGLYIGWRCPHYLWDCFRIGDESRCFCGHLLREHRIISDISVPCKVSQCRCFMFCFIPSRPEEVGEFWLKRRATFDPKAWRAQCRCKHSHEEHAATGPHPCRHHGCCCGCFESNFLCAACDRRWEEHETFFDTQKTRQRGGRPRGTDTVSNWHRPL" }, "locus": { "chromosome": "9", "end_pos": 35818472, "start_pos": 35826161, "strand": "+", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000423537", "id": "ENST00000423537", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000415299", "id": "ENSP00000415299", "database": "Ensembl Peptide" } ] } }, { "url": "https://www.uniprot.org/uniprot/A6H8Z2#A6H8Z2-2", "isoform_ac": "A6H8Z2-2", "sequence": { "header": "sp|A6H8Z2-2|F221B_HUMAN Isoform 2 of Protein FAM221B OS=Homo sapiens OX=9606 GN=FAM221B PE=2 SV=2 CANONICAL=A6H8Z2-1", "length": 156, "sequence": "MGLYIGWRCPHYLWDCFRIGDESRCFCGHLLREHRIISDISVPCKVSQCRCFMFCFIPSRPEEVGEFWLKRRATFDPKAWRAQCRCKHSHEEHAATGPHPCRHHGCCCGCFESNFLCAACDRRWEEHETFFDTQKTRQRGGRPRGTDTVSNWHRPL" }, "locus": {} }, { "url": "https://www.uniprot.org/uniprot/A6H8Z2#A6H8Z2-3", "isoform_ac": "A6H8Z2-3", "sequence": { "header": "sp|A6H8Z2-3|F221B_HUMAN Isoform 3 of Protein FAM221B OS=Homo sapiens OX=9606 GN=FAM221B PE=2 SV=2 CANONICAL=A6H8Z2-1", "length": 340, "sequence": "MEAHEIIEEPHITMDAEKHPPSKDPSAEDLQENHISESFLKPSTSETPLEPHTSESPLVPSPSQIPLEAHSPETHQEPSISETPSETPTYEASLDSPISVVPEKHLTLPPQSRDYVCLSSSDTLKEDLSSESSSNEVPWTRRSTHLSESESLPEHCLSGPSSQVQVDTTEKQEEEAGEVEKGVDASDSTAHTAQPGHQLGNTARPVFPARQTELVEVAKAMHREEFGAQVNNLFQWEKDAALNAIQTDRIRNSSSGILAPAHLHCDCLYLALSTKPPWCKGALALQAISIKTEEAKPKATSRQALDPDRLWVSTLAGAAPITYGTVSGLGMSPDAFVDTC" }, "locus": { "chromosome": "9", "end_pos": 35819914, "start_pos": 35826161, "strand": "+", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000388950", "id": "ENST00000388950", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000373602", "id": "ENSP00000373602", "database": "Ensembl Peptide" } ] } }, { "url": "https://www.uniprot.org/uniprot/A6H8Z2#C9JPK8-1", "isoform_ac": "C9JPK8-1", "sequence": { "header": "tr|C9JPK8-1|F221B_HUMAN Computationally mapped isoform of Protein FAM221B OS=Homo sapiens OX=9606 GN=FAM221B PE=2 SV=1 CANONICAL=A6H8Z2-1", "length": 90, "sequence": "MEAHEIIEEPHITMDAEKHPPSKDPSAEDLQENHISESFLKPSTSETPLEPHTSESPLVPSPSQIPLEAHSPETHQEPSISETPSETPTY" }, "locus": { "chromosome": "9", "end_pos": 35825892, "start_pos": 35826161, "strand": "+", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000472182", "id": "ENST00000472182", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000420279", "id": "ENSP00000420279", "database": "Ensembl Peptide" } ] } }, { "url": "https://www.uniprot.org/uniprot/A6H8Z2#F8W8N9-1", "isoform_ac": "F8W8N9-1", "sequence": { "header": "tr|F8W8N9-1|F221B_HUMAN Computationally mapped isoform of Protein FAM221B OS=Homo sapiens OX=9606 GN=FAM221B PE=2 SV=1 CANONICAL=A6H8Z2-1", "length": 301, "sequence": "MEAHEIIEEPHITMDAEKHPPSKDPSAEDLQENHISESFLKPSTSETPLEPHTSESPLVPSPSQIPLEAHSPETHQEPSISETPSETPTYEASLDSPISVVPEKHLTLPPQSRDYVCLSSSDTLKEDLSSESSSNEVPWTRRSTHLSESESLPEHCLSGPSSQVQVDTTEKQEEEAGEVEKGVDASDSTAHTAQPGHQLGNTARPVFPARQTELVEVAKAMHREEFGAQVNNLFQWEKDAALNAIQTGLYIGWRCPHYLWDCFRIGDESRCFCGHLLREHRIISDISVPCKVSQCRCFMFC" }, "locus": { "chromosome": "9", "end_pos": 35819345, "start_pos": 35826161, "strand": "+", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000377984", "id": "ENST00000377984", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000367222", "id": "ENSP00000367222", "database": "Ensembl Peptide" } ] } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:392307", "resource": "KEGG Pathway", "id": "hsa:392307", "name": "" } ], "function": [], "orthologs": [ { "uniprot_canonical_ac": "Q66HD8-1", "protein_name": "Protein FAM221B", "sequence": { "length": 507, "sequence": "MEADKTSEGPPATQDAKKHPSLTVPHAEDLPEATTPESPPHLLSSQEYFQPPKVHSKTYPSLDLGTKDSEDLQDPSVSETPLKLDTANLPSTPSQSSAQSVISLERAISKIPLDDFIYENSISEVQEEPLPLSPTTDISKYEYPISDVQEEPLLLSPTTNISKYEDSISDVQEEPLEDTPTADISETEYSISDVQEEPLEPPPTADIPESEDYISDDHEEPLEPPPTADIPESSYEFISDKVPQTQVPESEPFPKHSVPEPSAQAKEAASADEEEAEEEELTGGTSKTAAAGSEHHARKKKEKRGCESRPVVPAKRAELVEMAKAMHRKQFDDQVNDLFQWEKNSSLKAIQTGIYIGWRCPHYLWDCFRIGDESKCFCGHLLKEHQIISDLSVPCSVSQCRCLMFCFIPSRPEEVGEFWLKKRATFDPKAWRAQCRCKHTHEEHAATGSHPCRHRGCYCNSFESNFLCAACDRRWEEHETFFETEETKRRGKRPYGTNTAKNRHRPF" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/52184", "id": "52184", "database": "MGI" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q8C627-1", "protein_name": "Protein FAM221B", "sequence": { "length": 487, "sequence": "MEANKTTEGPQDTQDAKEQPSLEDTNAEDLYEATTHETPLQPSSSQKHFQPPEIHLETPASLNPDTKGAEGLQDSSVSGTPPVKSSSSGLLSLPPQLSPQSVTSLEKAIAEIPLEEFGYDSPISKVKEEPLQLSPTANIPEYGSPISEVQKESLEVSPTANIPEYGSPISEVQKEPLEVSSTANIPKYESPVSEVQKEPLEVSPTASIPESSHELTSDKVPQTQVPESEHFPKHSFSESPTQAKEDESTKEGEAGEDELAVGTSKIPAAKPGLRAKKKKEKRAGGVTSRPVVPAKRAELVEMAKAVHREQFDDQVNNLFQWEKDSTLKAIQTGIYIGWRCPHYLWDCFRIGDESKCFCGHLLREHQIISDLSVPCSVSQCRCLMFCFIPSRPEEVGEFWLKKRATFDPKAWRAQCRCKHTHEEHAATGAHPCRHRGCFCPSFESNFLCVACDRRWEEHETFFETGDTRRKGKRPYGANNIKNWHRTY" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/52184", "id": "52184", "database": "MGI" } ], "common_name": "Mouse", "organism": "Mus musculus", "tax_id": 10090 } ], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "L", "subjects_tested": "678", "alt_nt": "T", "chr_id": "9", "ref_nt": "A", "chr_pos": "35825563", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "BT - Brain tumour" }, { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "adult brain tumor" }, { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "adult malignant brain neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "brain neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "brain neoplasm, adult" }, { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "malignant brain tumour" }, { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "malignant primary brain neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "malignant primary brain tumor" }, { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "malignant tumor of Brain" }, { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "malignant tumor of adult brain" }, { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "neoplasm of brain" }, { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "primary brain neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "primary brain tumor" }, { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "primary malignant neoplasm of brain" }, { "url": "http://disease-ontology.org/term/DOID:1319", "description": "", "resource": "Disease Ontology", "id": "DOID:1319", "name": "tumor of the Brain" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1319", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain.", "resource": "Disease Ontology", "id": "DOID:1319", "name": "brain cancer" } }, { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:2531", "description": "", "resource": "Disease Ontology", "id": "DOID:2531", "name": "Hematologic malignancy" }, { "url": "http://disease-ontology.org/term/DOID:2531", "description": "", "resource": "Disease Ontology", "id": "DOID:2531", "name": "Hematologic neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:2531", "description": "", "resource": "Disease Ontology", "id": "DOID:2531", "name": "Hematological tumors" }, { "url": "http://disease-ontology.org/term/DOID:2531", "description": "", "resource": "Disease Ontology", "id": "DOID:2531", "name": "blood cancer" }, { "url": "http://disease-ontology.org/term/DOID:2531", "description": "", "resource": "Disease Ontology", "id": "DOID:2531", "name": "hematopoietic and lymphoid system tumor" }, { "url": "http://disease-ontology.org/term/DOID:2531", "description": "", "resource": "Disease Ontology", "id": "DOID:2531", "name": "hematopoietic cancer" }, { "url": "http://disease-ontology.org/term/DOID:2531", "description": "", "resource": "Disease Ontology", "id": "DOID:2531", "name": "hematopoietic neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:2531", "description": "", "resource": "Disease Ontology", "id": "DOID:2531", "name": "hematopoietic tumors" }, { "url": "http://disease-ontology.org/term/DOID:2531", "description": "", "resource": "Disease Ontology", "id": "DOID:2531", "name": "malignant hematopoietic neoplasm" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:2531", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes.", "resource": "Disease Ontology", "id": "DOID:2531", "name": "hematologic cancer" } }, { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:263", "description": "", "resource": "Disease Ontology", "id": "DOID:263", "name": "malignant neoplasm of kidney except pelvis" }, { "url": "http://disease-ontology.org/term/DOID:263", "description": "", "resource": "Disease Ontology", "id": "DOID:263", "name": "malignant tumour of kidney" }, { "url": "http://disease-ontology.org/term/DOID:263", "description": "", "resource": "Disease Ontology", "id": "DOID:263", "name": "renal cancer" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:263", "description": "A urinary system cancer that is located_in the kidney.", "resource": "Disease Ontology", "id": "DOID:263", "name": "kidney cancer" } } ], "glycoeffect": [], "end_pos": 199, "frequency": "1.0", "sequence_mut": "Q", "start_pos": 199, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "7", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A6H8Z2", "id": "A6H8Z2", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 2 out of 6 filters: patient freq. (1.0%); num. of cancers (3)." }, { "sequence_org": "A", "subjects_tested": "50", "alt_nt": "A", "chr_id": "9", "ref_nt": "G", "chr_pos": "35819262", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "Thyroid gland neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant tumour of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid neoplasm" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1781", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage.", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid gland cancer" } } ], "glycoeffect": [], "end_pos": 328, "frequency": "2.0", "sequence_mut": "V", "start_pos": 328, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A6H8Z2", "id": "A6H8Z2", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%)." }, { "sequence_org": "R", "subjects_tested": "93", "alt_nt": "T", "chr_id": "9", "ref_nt": "C", "chr_pos": "35818952", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:2394", "description": "", "resource": "Disease Ontology", "id": "DOID:2394", "name": "malignant Ovarian tumor" }, { "url": "http://disease-ontology.org/term/DOID:2394", "description": "", "resource": "Disease Ontology", "id": "DOID:2394", "name": "malignant tumour of ovary" }, { "url": "http://disease-ontology.org/term/DOID:2394", "description": "", "resource": "Disease Ontology", "id": "DOID:2394", "name": "ovarian neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:2394", "description": "", "resource": "Disease Ontology", "id": "DOID:2394", "name": "ovary neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:2394", "description": "", "resource": "Disease Ontology", "id": "DOID:2394", "name": "primary ovarian cancer" }, { "url": "http://disease-ontology.org/term/DOID:2394", "description": "", "resource": "Disease Ontology", "id": "DOID:2394", "name": "tumor of the Ovary" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:2394", "description": "A female reproductive organ cancer that is located_in the ovary.", "resource": "Disease Ontology", "id": "DOID:2394", "name": "ovarian cancer" } } ], "glycoeffect": [], "end_pos": 369, "frequency": "1.1", "sequence_mut": "H", "start_pos": 369, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A6H8Z2", "id": "A6H8Z2", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%). In dbSNP: rs1010181315." }, { "sequence_org": "K", "subjects_tested": "66", "alt_nt": "C", "chr_id": "9", "ref_nt": "T", "chr_pos": "35826038", "disease": [ { "synonyms": [], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1324", "description": "A respiratory system cancer that is located_in the lung.", "resource": "Disease Ontology", "id": "DOID:1324", "name": "lung cancer" } } ], "glycoeffect": [ "o-glyco-site-loss" ], "end_pos": 41, "frequency": "1.5", "sequence_mut": "E", "start_pos": 41, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A6H8Z2", "id": "A6H8Z2", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.5%)." } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012448.2", "ac": "NP_001012448.2", "name": "protein FAM221B", "summary": "" }, "go_annotation": {}, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A6H8Z2", "resource": "RefSeq", "type": "synonym", "name": "C9orf128" }, { "url": "https://www.uniprot.org/uniprot/A6H8Z2", "resource": "UniProtKB", "type": "synonym", "name": "C9orf128" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A6H8Z2", "resource": "RefSeq", "type": "synonym", "name": "FAM221B" }, { "url": "https://www.uniprot.org/uniprot/A6H8Z2", "resource": "UniProtKB", "type": "recommended", "name": "FAM221B" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A6H8Z2", "id": "A6H8Z2", "database": "BioMuta" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FAM221B", "id": "FAM221B", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/392307", "id": "392307", "database": "GeneID" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=30762", "id": "30762", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A6H8Z2*", "id": "A6H8Z2", "database": "IntAct" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR026755", "id": "IPR026755", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:392307", "id": "hsa:392307", "database": "KEGG Pathway" }, { "url": "https://www.nextprot.org/entry/NX_A6H8Z2", "id": "NX_A6H8Z2", "database": "neXtProt" }, { "url": "https://omabrowser.org/oma/group/CSCFESN/", "id": "CSCFESN", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=973186at2759", "id": "973186at2759", "database": "OrthoDB" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR31214", "id": "PTHR31214", "database": "PANTHER" }, { "url": "http://pfam.xfam.org/family/PF14753", "id": "PF14753", "database": "Pfam" }, { "url": "https://pharos.nih.gov/targets/A6H8Z2", "id": "A6H8Z2", "database": "PHAROS" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A6H8Z2", "id": "PR_A6H8Z2", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012448.2", "id": "NP_001012448.2", "database": "RefSeq" } ], "expression_disease": [ { "name": "Prostate cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "NGP - new growth of prostate" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "hereditary prostate cancer" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "malignant tumor of the prostate" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostate cancer, familial" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostate neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostatic cancer" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostatic neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "tumor of the prostate" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:10283", "description": "A male reproductive organ cancer that is located_in the prostate.", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostate cancer" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6H8Z2", "id": "A6H8Z2", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:10283", "significant": "No" }, { "name": "Urinary bladder cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:11054", "description": "", "resource": "Disease Ontology", "id": "DOID:11054", "name": "bladder cancer" }, { "url": "http://disease-ontology.org/term/DOID:11054", "description": "", "resource": "Disease Ontology", "id": "DOID:11054", "name": "tumor of the bladder" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:11054", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder.", "resource": "Disease Ontology", "id": "DOID:11054", "name": "urinary bladder cancer" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6H8Z2", "id": "A6H8Z2", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:11054", "significant": "No" }, { "name": "Thyroid gland cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "Thyroid gland neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant tumour of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid neoplasm" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1781", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage.", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid gland cancer" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6H8Z2", "id": "A6H8Z2", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:1781", "significant": "Yes" }, { "name": "Liver cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "Ca liver - primary" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "Resectable malignant neoplasm of Liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "hepatic cancer" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "hepatic neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant hepato-biliary neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant neoplasm of liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant neoplasm of liver, primary" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant tumor of liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "neoplasm of liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "primary liver cancer" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "primary malignant neoplasm of Liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "resectable malignant neoplasm of the liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:3571", "description": "A hepatobiliary system cancer that is located_in the liver.", "resource": "Disease Ontology", "id": "DOID:3571", "name": "liver cancer" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6H8Z2", "id": "A6H8Z2", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3571", "significant": "No" }, { "name": "Lung squamous cell carcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:3907", "description": "", "resource": "Disease Ontology", "id": "DOID:3907", "name": "Epidermoid cell carcinoma of the lung" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:3907", "description": "A non-small cell lung carcinoma that has_material_basis_in the squamous cell.", "resource": "Disease Ontology", "id": "DOID:3907", "name": "lung squamous cell carcinoma" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6H8Z2", "id": "A6H8Z2", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3907", "significant": "Yes" }, { "name": "Lung adenocarcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:3910", "description": "", "resource": "Disease Ontology", "id": "DOID:3910", "name": "bronchogenic lung adenocarcinoma" }, { "url": "http://disease-ontology.org/term/DOID:3910", "description": "", "resource": "Disease Ontology", "id": "DOID:3910", "name": "nonsmall cell adenocarcinoma" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:3910", "description": "A lung cancer that derives_from epithelial cells of glandular origin.", "resource": "Disease Ontology", "id": "DOID:3910", "name": "lung adenocarcinoma" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6H8Z2", "id": "A6H8Z2", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3910", "significant": "No" }, { "name": "Esophageal cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "Ca lower third oesophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "Ca middle third oesophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "esophagus cancer" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of distal third of esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of lower third of oesophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of middle third of oesophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of proximal third of esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of upper third esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant tumor of Distal Third of esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant tumor of Proximal Third of esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant tumor of abdominal esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant tumor of the middle Third of the esophagus" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:5041", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "resource": "Disease Ontology", "id": "DOID:5041", "name": "esophageal cancer" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A6H8Z2", "id": "A6H8Z2", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:5041", "significant": "No" } ], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 45394.0, "chemical_mass": 45394.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000204930", "id": "ENSG00000204930", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A6H8Z2", "name": "FAM221B", "locus": { "chromosome": "9", "end_pos": 35816391, "start_pos": 35828747, "strand": "-", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000204930", "id": "ENSG00000204930", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A6H8Z2", "resource": "UniProtKB", "type": "recommended", "name": "Protein FAM221B" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A6H8Z2", "resource": "RefSeq", "type": "synonym", "name": "protein FAM221B" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A6H8Z2", "resource": "RefSeq", "type": "synonym", "name": "uncharacterized protein C9orf128" } ] }