{ "uniprot_canonical_ac": "A4GTP4-1", "ptm_annotation": [ { "annotation": "On mitogenic stimulation, phosphorylated on C-terminal serine and threonine residues by MAPK1. Ser-382 and Ser-388 are the preferred sites for MAPK1. In vitro, phosphorylation by MAPK1 potentiates ternary complex formation with the serum responses factors, SRE and SRF. Also phosphorylated on Ser-382 by MAPK8 and/or MAKP9. Phosphorylation leads to loss of sumoylation and restores transcriptional activator activity. Phosphorylated and activated by CAMK4, MAPK11, MAPK12 and MAPK14 (By similarity). Upon bFGF stimulus, phosphorylated by PAK1 (PubMed:17156131).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/17156131", "id": "17156131", "database": "PubMed" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/P19419", "id": "P19419", "database": "PubMed" } ] }, { "annotation": "Sumoylation represses transcriptional activator activity as it results in recruitment of HDAC2 to target gene promoters which leads to decreased histone acetylation and reduced transactivator activity. It also regulates nuclear retention.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/P19419", "id": "P19419", "database": "PubMed" } ] } ], "sequence": { "header": "sp|A4GTP4-1|ELK1_RAT Isoform 1 of ETS domain-containing protein Elk-1 OS=Rattus norvegicus OX=10116 GN=Elk1 PE=1 SV=1 CANONICAL=A4GTP4-1", "length": 427, "sequence": "MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAVAMAPATVHSGPGDNATGKPGTPKGAGMTGQGGLARSSRNEYMRSGLYSTFTIQSLQPQPPLHPRPASVLPNTTPAGVPAPPSGSRSTSPNPLEACLEAEEAGLPLQVILTPPEAPNQKSEELSLNPGFGRPQPPEVKVEGPKEELEVTEVGGFSPEAVKAEQEVSPSEGLLARLPAILTENTAQVCGLSTSTTEITQPQKGRKPRDLELPLSPSLLGGQGPERTPGSGTSSGLQAQGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP" }, "uniprot_id": "ELK1_RAT", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Rat", "taxid": 10116, "name": "Rattus norvegicus", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] } ], "crossref_internal": { "gene": [ "Elk1" ], "site": [ "A4GTP4-1.335.335", "A4GTP4-1.382.382", "A4GTP4-1.125.127", "A4GTP4-1.362.362", "A4GTP4-1.352.352", "A4GTP4-1.388.388", "A4GTP4-1.51.53", "A4GTP4-1.421.421", "A4GTP4-1.182.184", "A4GTP4-1.416.416", "A4GTP4-1.323.323", "A4GTP4-1.367.367" ], "species": [ 10116 ] }, "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/10891039", "type": [ "PubMed" ], "id": "10891039" } ], "title": "Increased levels of transcription factors Elk-1, cyclic adenosine monophosphate response element-binding protein, and activating transcription factor 2 in the cerebellar vermis of schizophrenic patients.", "journal": "Archives of general psychiatry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "id": "NP_001101529.1", "database": "RefSeq" } ], "authors": "Kyosseva SV, Elbein AD, Hutton TL, Griffin ST, Mrak RE, Sturner WQ, Karson CN", "date": "2000" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/11050086", "type": [ "PubMed" ], "id": "11050086" } ], "title": "Opposing roles of Elk-1 and its brain-specific isoform, short Elk-1, in nerve growth factor-induced PC12 differentiation.", "journal": "The Journal of biological chemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "id": "NP_001101529.1", "database": "RefSeq" } ], "authors": "Vanhoutte P, Nissen JL, Brugg B, Gaspera BD, Besson MJ, Hipskind RA, Caboche J", "date": "2001" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/12023815", "type": [ "PubMed" ], "id": "12023815" } ], "title": "Complexities in ETS-domain transcription factor function and regulation: lessons from the TCF (ternary complex factor) subfamily. The Colworth Medal Lecture.", "journal": "Biochemical Society transactions", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "id": "NP_001101529.1", "database": "RefSeq" } ], "authors": "Sharrocks AD", "date": "2002" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/17156131", "type": [ "PubMed" ], "id": "17156131" } ], "title": "JNK- and Rac1-dependent induction of immediate early gene pip92 suppresses neuronal differentiation.", "journal": "J. Neurochem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ], "authors": "Kim E.J., Chung K.C., Park J.B., Seo S.R., Yang E.J.", "date": "2007" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/22354998", "type": [ "PubMed" ], "id": "22354998" } ], "title": "Alternative splicing within the elk-1 5' untranslated region serves to modulate initiation events downstream of the highly conserved upstream open reading frame 2.", "journal": "Molecular and cellular biology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "id": "NP_001101529.1", "database": "RefSeq" } ], "authors": "Rahim G, Araud T, Jaquier-Gubler P, Curran J", "date": "2012" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/23516302", "type": [ "PubMed" ], "id": "23516302" } ], "title": "Centaurin-alpha1-Ras-Elk-1 signaling at mitochondria mediates beta-amyloid-induced synaptic dysfunction.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "id": "NP_001101529.1", "database": "RefSeq" } ], "authors": "Szatmari EM, Oliveira AF, Sumner EJ, Yasuda R", "date": "2013" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/24075908", "type": [ "PubMed" ], "id": "24075908" } ], "title": "Insulin-activated Elk-1 recruits the TIP60/NuA4 complex to increase prolactin gene transcription.", "journal": "Molecular and cellular endocrinology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "id": "NP_001101529.1", "database": "RefSeq" } ], "authors": "Mahajan MA, Stanley FM", "date": "2014" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/30053446", "type": [ "PubMed" ], "id": "30053446" } ], "title": "ETS-domain containing protein (Elk1) suppression protects cortical neurons against oxygen-glucose deprivation injury.", "journal": "Experimental cell research", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "id": "NP_001101529.1", "database": "RefSeq" } ], "authors": "Lu Z, Miao Z, Zhu J, Zhu G", "date": "2018" } ], "uniprot_ac": "A4GTP4", "site_annotation": [ { "end_pos": 127, "annotation": "n_glycosylation_sequon", "start_pos": 125 }, { "end_pos": 184, "annotation": "n_glycosylation_sequon", "start_pos": 182 }, { "end_pos": 53, "annotation": "n_glycosylation_sequon", "start_pos": 51 } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4#A4GTP4-1", "isoform_ac": "A4GTP4-1", "sequence": { "header": "sp|A4GTP4-1|ELK1_RAT Isoform 1 of ETS domain-containing protein Elk-1 OS=Rattus norvegicus OX=10116 GN=Elk1 PE=1 SV=1 CANONICAL=A4GTP4-1", "length": 427, "sequence": "MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAVAMAPATVHSGPGDNATGKPGTPKGAGMTGQGGLARSSRNEYMRSGLYSTFTIQSLQPQPPLHPRPASVLPNTTPAGVPAPPSGSRSTSPNPLEACLEAEEAGLPLQVILTPPEAPNQKSEELSLNPGFGRPQPPEVKVEGPKEELEVTEVGGFSPEAVKAEQEVSPSEGLLARLPAILTENTAQVCGLSTSTTEITQPQKGRKPRDLELPLSPSLLGGQGPERTPGSGTSSGLQAQGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP" }, "locus": { "chromosome": "X", "end_pos": 1297144, "start_pos": 1303526, "strand": "-", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000013522", "id": "ENSRNOT00000013522", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000013522", "id": "ENSRNOP00000013522", "database": "Ensembl Peptide" } ] } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:314436", "resource": "KEGG Pathway", "id": "rno:314436", "name": "" } ], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "annotation": "Elk1 suppression protects cortical neurons against oxygen-glucose deprivation injury. Erratum:[Exp Cell Res. 2018 Nov 1;372(1):83. PMID: 30266209]", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "id": "NP_001101529.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "annotation": "Insulin activates prolactin gene transcription by activating Elk-1 that recruits the NuA4 complex to the promoter.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "id": "NP_001101529.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "annotation": "The CentA1-Ras-Elk-1 signaling pathway acts on mitochondria to regulate dendritic spine density and synaptic plasticity in response to Abeta in hippocampal neurons.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "id": "NP_001101529.1", "database": "RefSeq" } ] }, { "url": "https://www.uniprot.org/uniprot/A4GTP4#function", "annotation": "Transcription factor that binds to purine-rich DNA sequences. Forms a ternary complex with SRF and the ETS and SRF motifs of the serum response element (SRE) on the promoter region of immediate early genes such as FOS and IER2 (By similarity) (PubMed:17156131). Induces target gene transcription upon JNK-signaling pathway stimulation (PubMed:17156131).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4#function", "id": "A4GTP4", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "P19419-1", "protein_name": "ETS domain-containing protein Elk-1", "sequence": { "length": 428, "sequence": "MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A4GTP4/", "id": "A4GTP4", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/3832", "id": "3832", "database": "MGI" } ], "common_name": "Human", "organism": "Homo sapiens", "tax_id": 9606 }, { "uniprot_canonical_ac": "P41969-1", "protein_name": "ETS domain-containing protein Elk-1", "sequence": { "length": 429, "sequence": "MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAIAMAPATVHAGPGDTATGKPGTPKGAGMTGQGGLARSSRNEYMRSGLYSTFTIQSLQPQPQPPIPPRPASVLPNTTPAGVPAPASGSRSTSPNPLEACLEAEEAGLPLQVILTPPEAPNQKSEELSLDPSFGHPQPPEVKVEGPKEELEAARAGGFSSEAVKAEPEVSASEGLLARLPAILTENTAQVCGLSTSTTEITQPQKGRKPRDLELPLSPSLLGGQGPERTPGSGTSSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A4GTP4/", "id": "A4GTP4", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/3832", "id": "3832", "database": "MGI" } ], "common_name": "Mouse", "organism": "Mus musculus", "tax_id": 10090 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "ac": "NP_001101529.1", "name": "ETS domain-containing protein Elk-1", "summary": "This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. Multiple isoforms are produced from this gene by the use of alternative translational start codons. [provided by RefSeq, Mar 2012]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "pmid": "18768922", "id": "GO:0003682", "name": "chromatin binding", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003690", "pmid": "11557580", "id": "GO:0003690", "name": "double-stranded DNA binding", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "pmid": "11557580", "id": "GO:0000978", "name": "RNA polymerase II proximal promoter sequence-specific DNA binding", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "pmid": "21873635", "id": "GO:0000981", "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001085", "pmid": "", "id": "GO:0001085", "name": "RNA polymerase II transcription factor binding", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "pmid": "", "id": "GO:0001228", "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] } ], "total": 6, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "pmid": "9412502", "id": "GO:0005634", "name": "nucleus", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "pmid": "9412502", "id": "GO:0005737", "name": "cytoplasm", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "pmid": "16549787", "id": "GO:0005739", "name": "mitochondrion", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "pmid": "16549787", "id": "GO:0030425", "name": "dendrite", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "pmid": "16549787", "id": "GO:0043025", "name": "neuronal cell body", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043679", "pmid": "9412502", "id": "GO:0043679", "name": "axon terminus", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "pmid": "", "id": "GO:0005654", "name": "nucleoplasm", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] } ], "total": 7, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "pmid": "21873635", "id": "GO:0006357", "name": "regulation of transcription by RNA polymerase II", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "pmid": "21873635", "id": "GO:0030154", "name": "cell differentiation", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "pmid": "19029245", "id": "GO:0045944", "name": "positive regulation of transcription by RNA polymerase II", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071394", "pmid": "14766003", "id": "GO:0071394", "name": "cellular response to testosterone stimulus", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901216", "pmid": "16549787", "id": "GO:1901216", "name": "positive regulation of neuron death", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009416", "pmid": "10383826", "id": "GO:0009416", "name": "response to light stimulus", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071774", "pmid": "17156131", "id": "GO:0071774", "name": "response to fibroblast growth factor", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071480", "pmid": "17949253", "id": "GO:0071480", "name": "cellular response to gamma radiation", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071396", "pmid": "18768922", "id": "GO:0071396", "name": "cellular response to lipid", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] } ], "total": 9, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A4GTP4", "resource": "RefSeq", "type": "synonym", "name": "Elk1" }, { "url": "https://www.uniprot.org/uniprot/A4GTP4", "resource": "UniProtKB", "type": "recommended", "name": "Elk1" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000010171", "id": "ENSRNOG00000010171", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/314436", "id": "314436", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000418", "id": "IPR000418", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388", "id": "IPR036388", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "id": "IPR036390", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:314436", "id": "rno:314436", "database": "KEGG Pathway" }, { "url": "https://omabrowser.org/oma/group/NTAQVCG/", "id": "NTAQVCG", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=981551at2759", "id": "981551at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF00178", "id": "PF00178", "database": "Pfam" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A4GTP4", "id": "PR_A4GTP4", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001101529.1", "id": "NP_001101529.1", "database": "RefSeq" }, { "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1598663", "id": "1598663", "database": "RGD" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [ { "residue": "Ser", "position": "323", "kinase_gene_name": "", "kinase_uniprot_canonical_ac": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "residue": "Thr", "position": "335", "kinase_gene_name": "", "kinase_uniprot_canonical_ac": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "residue": "Thr", "position": "352", "kinase_gene_name": "", "kinase_uniprot_canonical_ac": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "residue": "Thr", "position": "362", "kinase_gene_name": "", "kinase_uniprot_canonical_ac": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "residue": "Thr", "position": "367", "kinase_gene_name": "", "kinase_uniprot_canonical_ac": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "residue": "Ser", "position": "382", "kinase_gene_name": "", "kinase_uniprot_canonical_ac": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "residue": "Ser", "position": "388", "kinase_gene_name": "", "kinase_uniprot_canonical_ac": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "residue": "Thr", "position": "416", "kinase_gene_name": "", "kinase_uniprot_canonical_ac": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] }, { "residue": "Ser", "position": "421", "kinase_gene_name": "", "kinase_uniprot_canonical_ac": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "id": "A4GTP4", "database": "UniProtKB" } ] } ], "mass": { "monoisotopic_mass": 45272.0, "chemical_mass": 45272.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A4GTP4", "name": "Elk1", "locus": { "chromosome": "X", "end_pos": 1304822, "start_pos": 1297099, "strand": "+", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOG00000010171", "id": "ENSRNOG00000010171", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A4GTP4", "resource": "RefSeq", "type": "synonym", "name": "ELK1, member of ETS oncogene family; ELK1, ETS transcription factor" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A4GTP4", "resource": "RefSeq", "type": "synonym", "name": "ETS domain-containing protein Elk-1" }, { "url": "https://www.uniprot.org/uniprot/A4GTP4", "resource": "UniProtKB", "type": "recommended", "name": "ETS domain-containing protein Elk-1" } ] }