{ "uniprot_canonical_ac": "A4D1B5-1", "ptm_annotation": [ { "annotation": "The protein is first synthesized as a holoprotein form of 98 kDa and rapidly processed into the gamma-secretase-activating protein 16 kDa C-terminal form, which constitutes the predominant form.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D1B5", "id": "A4D1B5", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/20811458", "id": "20811458", "database": "PubMed" } ] } ], "sequence": { "header": "sp|A4D1B5-1|GSAP_HUMAN Isoform 1 of Gamma-secretase-activating protein OS=Homo sapiens OX=9606 GN=GSAP PE=1 SV=2 CANONICAL=A4D1B5-1", "length": 854, "sequence": "MALRLVADFDLGKDVLPWLRAQRAVSEASGAGSGGADVLENDYESLHVLNVERNGNIIYTYKDDKGNVVFGLYDCQTRQNELLYTFEKDLQVFSCSVNSERTLLAASLVQSTKEGKRNELQPGSKCLTLLVEIHPVNNVKVLKAVDSYIWVQFLYPHIESHPLPENHLLLISEEKYIEQFRIHVAQEDGNRVVIKNSGHLPRDRIAEDFVWAQWDMSEQRLYYIDLKKSRSILKCIQFYADESYNLMFEVPLDISLSNSGFKLVNFGCDYHQYRDKFSKHLTLCVFTNHTGSLCVCYSPKCASWGQITYSVFYIHKGHSKTFTTSLENVGSHMTKGITFLNLDYYVAVYLPGHFFHLLNVQHPDLICHNLFLTGNNEMIDMLPHCPLQSLSGSLVLDCCSGKLYRALLSQSSLLQLLQNTCLDCEKMAALHCALYCGQGAQFLEAQIIQWISENVSACHSFDLIQEFIIASSYWSVYSETSNMDKLLPHSSVLTWNTEIPGITLVTEDIALPLMKVLSFKGYWEKLNSNLEYVKYAKPHFHYNNSVVRREWHNLISEEKTGKRRSAAYVRNILDNAVKVISNLEARNLGPRLTPLLQEEDSHQRLLMGLMVSELKDHFLRHLQGVEKKKIEQMVLDYISKLLDLICHIVETNWRKHNLHSWVLHFNSRGSAAEFAVFHIMTRILEATNSLFLPLPPGFHTLHTILGVQCLPLHNLLHCIDSGVLLLTETAVIRLMKDLDNTEKNEKLKFSIIVRLPPLIGQKICRLWDHPMSSNIISRNHVTRLLQNYKKQPRNSMINKSSFSVEFLPLNYFIEILTDIESSNQALYPFEGHDNVDAEFVEEAALKHTAMLLGL" }, "uniprot_id": "GSAP_HUMAN", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Human", "taxid": 9606, "name": "Homo sapiens", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D1B5", "id": "A4D1B5", "database": "UniProtKB" } ] } ], "crossref_internal": { "gene": [ "GSAP" ], "species": [ 9606 ], "disease": [ "DOID:1324", "DOID:11054", "DOID:9256", "DOID:2394", "DOID:1781", "DOID:1612", "DOID:10283", "DOID:3907", "DOID:3571", "DOID:3910", "DOID:5041" ], "site": [ "A4D1B5-1.433.433", "A4D1B5-1.183.183", "A4D1B5-1.798.800", "A4D1B5-1.604.604", "A4D1B5-1.71.71", "A4D1B5-1.439.439", "A4D1B5-1.653.653", "A4D1B5-1.543.545", "A4D1B5-1.305.305", "A4D1B5-1.288.290", "A4D1B5-1.454.456", "A4D1B5-1.241.241" ] }, "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/16341674", "type": [ "PubMed" ], "id": "16341674" } ], "title": "Transcriptome analysis of human gastric cancer.", "journal": "Mammalian genome : official journal of the International Mammalian Genome Society", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "id": "NP_059135.2", "database": "RefSeq" } ], "authors": "Oh JH, Yang JO, Hahn Y, Kim MR, Byun SS, Jeon YJ, Kim JM, Song KS, Noh SM, Kim S, Yoo HS, Kim YS, Kim NS", "date": "2005" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/20811458", "type": [ "PubMed" ], "id": "20811458" } ], "title": "Gamma-secretase activating protein is a therapeutic target for Alzheimer's disease.", "journal": "Nature", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D1B5", "id": "A4D1B5", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "id": "NP_059135.2", "database": "RefSeq" } ], "authors": "Bettayeb K., Flajolet M., Gorelick F., Greengard P., He G., Hendrick J., Li P., Luo W., Netzer W.J., Remmers C., Wennogle L.P.", "date": "2010" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21718343", "type": [ "PubMed" ], "id": "21718343" } ], "title": "Immunohistochemical characterization of gamma-secretase activating protein expression in Alzheimer's disease brains.", "journal": "Neuropathology and applied neurobiology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "id": "NP_059135.2", "database": "RefSeq" } ], "authors": "Satoh J, Tabunoki H, Ishida T, Saito Y, Arima K", "date": "2012" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/23209290", "type": [ "PubMed" ], "id": "23209290" } ], "title": "The role of gamma-secretase activating protein (GSAP) and imatinib in the regulation of gamma-secretase activity and amyloid-beta generation.", "journal": "The Journal of biological chemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "id": "NP_059135.2", "database": "RefSeq" } ], "authors": "Hussain I, Fabregue J, Anderes L, Ousson S, Borlat F, Eligert V, Berger S, Dimitrov M, Alattia JR, Fraering PC, Beher D", "date": "2013" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/25037285", "type": [ "PubMed" ], "id": "25037285" } ], "title": "Common GSAP promoter variant contributes to Alzheimer's disease liability.", "journal": "Neurobiology of aging", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "id": "NP_059135.2", "database": "RefSeq" } ], "authors": "Zhu M, Tao Y, He Q, Gao H, Song F, Sun YM, Li HL, Wu ZY, Saffen D", "date": "2014" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/26076991", "type": [ "PubMed" ], "id": "26076991" } ], "title": "Regulation of gamma-secretase activating protein by the 5Lipoxygenase: in vitro and in vivo evidence.", "journal": "Scientific reports", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "id": "NP_059135.2", "database": "RefSeq" } ], "authors": "Chu J, Li JG, Hoffman NE, Stough AM, Madesh M, Pratico D", "date": "2015" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/28743126", "type": [ "PubMed" ], "id": "28743126" } ], "title": "Frontal Cortex and Hippocampal gamma-Secretase Activating Protein Levels in Prodromal Alzheimer Disease.", "journal": "Neuro-degenerative diseases", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "id": "NP_059135.2", "database": "RefSeq" } ], "authors": "Perez SE, Nadeem M, Malek-Ahmadi MH, He B, Mufson EJ", "date": "2017" } ], "uniprot_ac": "A4D1B5", "site_annotation": [ { "end_pos": 290, "annotation": "n_glycosylation_sequon", "start_pos": 288 }, { "end_pos": 456, "annotation": "n_glycosylation_sequon", "start_pos": 454 }, { "end_pos": 545, "annotation": "n_glycosylation_sequon", "start_pos": 543 }, { "end_pos": 800, "annotation": "n_glycosylation_sequon", "start_pos": 798 } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A4D1B5#A4D1B5-1", "isoform_ac": "A4D1B5-1", "sequence": { "header": "sp|A4D1B5-1|GSAP_HUMAN Isoform 1 of Gamma-secretase-activating protein OS=Homo sapiens OX=9606 GN=GSAP PE=1 SV=2 CANONICAL=A4D1B5-1", "length": 854, "sequence": "MALRLVADFDLGKDVLPWLRAQRAVSEASGAGSGGADVLENDYESLHVLNVERNGNIIYTYKDDKGNVVFGLYDCQTRQNELLYTFEKDLQVFSCSVNSERTLLAASLVQSTKEGKRNELQPGSKCLTLLVEIHPVNNVKVLKAVDSYIWVQFLYPHIESHPLPENHLLLISEEKYIEQFRIHVAQEDGNRVVIKNSGHLPRDRIAEDFVWAQWDMSEQRLYYIDLKKSRSILKCIQFYADESYNLMFEVPLDISLSNSGFKLVNFGCDYHQYRDKFSKHLTLCVFTNHTGSLCVCYSPKCASWGQITYSVFYIHKGHSKTFTTSLENVGSHMTKGITFLNLDYYVAVYLPGHFFHLLNVQHPDLICHNLFLTGNNEMIDMLPHCPLQSLSGSLVLDCCSGKLYRALLSQSSLLQLLQNTCLDCEKMAALHCALYCGQGAQFLEAQIIQWISENVSACHSFDLIQEFIIASSYWSVYSETSNMDKLLPHSSVLTWNTEIPGITLVTEDIALPLMKVLSFKGYWEKLNSNLEYVKYAKPHFHYNNSVVRREWHNLISEEKTGKRRSAAYVRNILDNAVKVISNLEARNLGPRLTPLLQEEDSHQRLLMGLMVSELKDHFLRHLQGVEKKKIEQMVLDYISKLLDLICHIVETNWRKHNLHSWVLHFNSRGSAAEFAVFHIMTRILEATNSLFLPLPPGFHTLHTILGVQCLPLHNLLHCIDSGVLLLTETAVIRLMKDLDNTEKNEKLKFSIIVRLPPLIGQKICRLWDHPMSSNIISRNHVTRLLQNYKKQPRNSMINKSSFSVEFLPLNYFIEILTDIESSNQALYPFEGHDNVDAEFVEEAALKHTAMLLGL" }, "locus": { "chromosome": "7", "end_pos": 77311361, "start_pos": 77416321, "strand": "+", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000257626", "id": "ENST00000257626", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000257626", "id": "ENSP00000257626", "database": "Ensembl Peptide" } ] } }, { "url": "https://www.uniprot.org/uniprot/A4D1B5#A4D1B5-2", "isoform_ac": "A4D1B5-2", "sequence": { "header": "sp|A4D1B5-2|GSAP_HUMAN Isoform 2 of Gamma-secretase-activating protein OS=Homo sapiens OX=9606 GN=GSAP PE=1 SV=2 CANONICAL=A4D1B5-1", "length": 577, "sequence": "MALRLVADFDLGKDVLPWLRAQRAVSEASGAGSGGADVLENDYESLHVLNVERNGNIIYTYKDDKGNVVFGLYDCQTRQNELLYTFEKDLQVFSCSVNSERTLLAASLVQSTKEGKRNELQPGSKCLTLLVEIHPVNNVKVLKAVDSYIWVQFLYPHIESHPLPENHLLLISEEKYIEQFRIHVAQEDGNRVVIKNSGHLPRDRIAEDFVWAQWDMSEQRLYYIDLKKSRSILKCIQFYADESYNLMFEVPLDISLSNSGFKLVNFGCDYHQYRDKFSKHLTLCVFTNHTGSLCVCYSPKCASWGQITYSVFYIHKGHSKTFTTSLENVGSHMTKGITFLNLDYYVAVYLPGHFFHLLNVQHPDLICHNLFLTGNNEMIDMLPHCPLQSLSGSLVLDCCSGKLYRALLSQSSLLQLLQNTCLDCEKMAALHCALYCGQGAQFLEAQWRQRADLNTNRVLSDFLKIIQWISENVSACHSFDLIQEFIIASSYWSVYSETSNMDKLLPHSSVLTWNTEIPGITLVTEDIALPLMKVLSFKGYWEKLNSNLEYVKYAKPHFHYNNSVVRREWHNLISEEV" }, "locus": {} }, { "url": "https://www.uniprot.org/uniprot/A4D1B5#A4D1B5-3", "isoform_ac": "A4D1B5-3", "sequence": { "header": "sp|A4D1B5-3|GSAP_HUMAN Isoform 3 of Gamma-secretase-activating protein OS=Homo sapiens OX=9606 GN=GSAP PE=1 SV=2 CANONICAL=A4D1B5-1", "length": 559, "sequence": "MALRLVADFDLGKDVLPWLRAQRAVSEASGAGSGGADVLENDYESLHVLNVERNGNIIYTYKDDKGNVVFGLYDCQTRQNELLYTFEKDLQVFSCSVNSERTLLAASLVQSTKEGKRNELQPGSKCLTLLVEIHPVNNVKVLKAVDSYIWVQFLYPHIESHPLPENHLLLISEEKYIEQFRIHVAQEDGNRVVIKNSGHLPRDRIAEDFVWAQWDMSEQRLYYIDLKKSRSILKCIQFYADESYNLMFEVPLDISLSNSGFKLVNFGCDYHQYRDKFSKHLTLCVFTNHTGSLCVCYSPKCASWGQITYSVFYIHKGHSKTFTTSLENVGSHMTKGITFLNLDYYVAVYLPGHFFHLLNVQHPDLICHNLFLTGNNEMIDMLPHCPLQSLSGSLVLDCCSGKLYRALLSQSSLLQLLQNTCLDCEKMAALHCALYCGQGAQFLEAQIIQWISENVSACHSFDLIQEFIIASSYWSVYSETSNMDKLLPHSSVLTWNTEIPGITLVTEDIALPLMKVLSFKGYWEKLNSNLEYVKYAKPHFHYNNSVVRREWHNLISEEV" }, "locus": {} }, { "url": "https://www.uniprot.org/uniprot/A4D1B5#A4D1B5-4", "isoform_ac": "A4D1B5-4", "sequence": { "header": "sp|A4D1B5-4|GSAP_HUMAN Isoform 4 of Gamma-secretase-activating protein OS=Homo sapiens OX=9606 GN=GSAP PE=1 SV=2 CANONICAL=A4D1B5-1", "length": 248, "sequence": "MGLMVSELKDHFLRHLQGVEKKKIEQMVLDYISKLLDLICHIVETNWRKHNLHSWVLHFNSRGSAAEFAVFHIMTRILEATNSLFLPLPPGFHTLHTILGVQCLPLHNLLHCIDSGVLLLTETAVIRLMKDLDNTEKNEKLKFSIIVRLPPLIGQKICRLWDHPMSSNIISRNHVTRLLQNYKKQPRNSMINKSSFSVEFLPLNYFIEILTDIESSNQALYPFEGHDNVDAEFVEEAALKHTAMLLGL" }, "locus": {} }, { "url": "https://www.uniprot.org/uniprot/A4D1B5#B7ZL33-1", "isoform_ac": "B7ZL33-1", "sequence": { "header": "tr|B7ZL33-1|GSAP_HUMAN Computationally mapped isoform of Gamma-secretase-activating protein OS=Homo sapiens OX=9606 GN=GSAP PE=1 SV=1 CANONICAL=A4D1B5-1", "length": 175, "sequence": "MTRILEATNSLFLPLPPGFHTLHTILGVQCLPLHNLLHCIDSGVLLLTETAVIRLMKDLDNTEKNEKLKFSIIVRLPPLIGQKICRLWDHPMSSNIISRNHVTRLLQNYKKQPRNSMINKSSFSVEFLPLNYFIEILTDIESSNQALYPFEGHDNVDAEFVEEAALKHTAMLLGL" }, "locus": { "chromosome": "7", "end_pos": 77311361, "start_pos": 77320776, "strand": "+", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000441833", "id": "ENST00000441833", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000415402", "id": "ENSP00000415402", "database": "Ensembl Peptide" } ] } }, { "url": "https://www.uniprot.org/uniprot/A4D1B5#C9JRG7-1", "isoform_ac": "C9JRG7-1", "sequence": { "header": "tr|C9JRG7-1|GSAP_HUMAN Computationally mapped isoform of Gamma-secretase-activating protein OS=Homo sapiens OX=9606 GN=GSAP PE=1 SV=1 CANONICAL=A4D1B5-1", "length": 58, "sequence": "MLKEMEILFIPIRMIREMSSLDYMIVKPDKMSFYIPLRKTCKFSVALSTVKGLCLLQV" }, "locus": { "chromosome": "7", "end_pos": 77397027, "start_pos": 77406066, "strand": "+", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000430584", "id": "ENST00000430584", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000402748", "id": "ENSP00000402748", "database": "Ensembl Peptide" } ] } }, { "url": "https://www.uniprot.org/uniprot/A4D1B5#H7C0Q7-1", "isoform_ac": "H7C0Q7-1", "sequence": { "header": "tr|H7C0Q7-1|GSAP_HUMAN Computationally mapped isoform of Gamma-secretase-activating protein OS=Homo sapiens OX=9606 GN=GSAP PE=1 SV=1 CANONICAL=A4D1B5-1", "length": 188, "sequence": "VLSFKGYWEKLNSNLEYVKYAKPHFHYNNSVVRREWHNLISEEKTGKRRSAAYVRNILDNAVKVISNLEARNLGPRLTPLLQEEDSHQRLLMGLLDLICHIVETNWRKHNLHSWVLHFNSRGSAAEFAVFHIMTRILEATNSLFLPLPPGFHTLHTILGVQCLPLHNLLHCIDSGVLLLTETAVIRLM" }, "locus": { "chromosome": "7", "end_pos": 77314374, "start_pos": 77330367, "strand": "+", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000415112", "id": "ENST00000415112", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000396230", "id": "ENSP00000396230", "database": "Ensembl Peptide" } ] } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:54103", "resource": "KEGG Pathway", "id": "hsa:54103", "name": "" } ], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "annotation": "A gamma-secretase activating protein (GSAP) that selectively increases amyloid-beta production via interactions with both gamma-secretase and its substrate, the amyloid precursor protein carboxy-terminal fragment.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "id": "NP_059135.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "annotation": "Aberrant regulation of gamma-secretase activating protein expression plays a key role in acceleration of gamma-cleavage of beta-secretase-cleaved C-terminal fragment of amyloid precursor protein and accumulation of Abeta in AD brains", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "id": "NP_059135.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "annotation": "GSAP cleavage via caspase-3 is regulated and depend upon the availability of 5-Lipoxygenase in Alzheimer's disease. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "id": "NP_059135.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "annotation": "Gamma-secretase activating protein (GSAP) and imatinib have roles in the regulation of gamma-secretase activity and amyloid-beta generation", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "id": "NP_059135.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "annotation": "Its promoter variant contributes to Alzheimer's disease liability.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "id": "NP_059135.2", "database": "RefSeq" } ] }, { "url": "https://www.uniprot.org/uniprot/A4D1B5#function", "annotation": "Regulator of gamma-secretase activity, which specifically activates the production of amyloid-beta protein (amyloid-beta protein 40 and amyloid-beta protein 42), without affecting the cleavage of other gamma-secretase targets such has Notch. The gamma-secretase complex is an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). Specifically promotes the gamma-cleavage of APP CTF-alpha (also named APP-CTF) by the gamma-secretase complex to generate amyloid-beta, while it reduces the epsilon-cleavage of APP CTF-alpha, leading to a low production of AICD.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D1B5#function", "id": "A4D1B5", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "annotation": "These data demonstrate that GSAP proteins are differentially dysregulated in severe Alzheimer Disease, but only the full-length form was associated with cognitive test scores in Alzheimer Disease.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "id": "NP_059135.2", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2JWZ3-1", "protein_name": "Gamma-secretase-activating protein", "sequence": { "length": 846, "sequence": "MALRLVTHFDVLADVLPSLLVQAATADEGDEGAETTLGSLRVLNIERNGDIIYTYKDNKGNAVFGIFDCQTRENEHLYTFEKDMQAVSCSVNSERTVLAASFIQYTEGVRSELQPGSKCLTLLVEIHPVNNVTVLKAVDSCVWVQFLYPQAESHLLAQNHLLLISEEKYIERFHIQITREDGNRVVIRNSSHLPRERIAEDFVWAQWDVSEQRIHYIELQESRSILKCVQFWADESFTIMFEMPLDISLSGLRFKLVNFGYDYRQDQAKLCHQPSLCIFTNHTGSLCVCYSPKSDSWKEITYSVFYLHKGYRKTFTVAPGSTDSQVANGVTFLNLGYFVAVYSPCRFLHLLNIRHPDLICHSLFLTGNNKTAAVLPPSPLQSLPGSLILDCSSGKVYRATLDQSYLMGFLWNAQLDCEKMAALHCALSCDSDPGFPEQIVQWVSERVSACHSFDLIQEFLIASSYWSVYPGLDDVDLLLPYSSVLTWDTEIPGMKLVTEELPLPLMKVYSLKGYWAKLNSNLEYIKYTKPHLHYHNSVVRREWHNLISEERTGKRRSTMYVRNILDNAVKVISNMEMKTFEPRLIPLLQEEDRHQRLLMGLMVSELRDHLLRHLQGVEKKKIEQMVLDYISKLLDLVWCLLETSWRKHSVHPWVLHLNEHGSPADFEVFHLMTRILDAASSLCFPLPPGFHSLHTILGVHCLPLYNLLHYIDNGVLLLTETVVTRLMKDLDNSEKNEKLKFSIIVRLPPLIGQKVCRLWDHPMSSNIISRNHVAQLLKNYKKEPQSSMIDKSSFPVEFLPLNYFIEILMHLESSNQALHGFEGHDNVDAEFVEEAALKHTTSLLGL" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/45504", "id": "45504", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A4D1B5/", "id": "A4D1B5", "database": "OMA" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q3TCV3-1", "protein_name": "Gamma-secretase-activating protein", "sequence": { "length": 858, "sequence": "MALRLVTHFDVLEDVLPSLLTQAATTDEGDRAGVLETTYGSLRVLNIERNGNIIYTYKDNKGNAVFGLYDCQTRQNEHLYTFEKDMQAVSCSVNSERTVLAASFIQYTTEGVKNDLQPGSKCLTLLVEIHPVNNVKVLKAVDSCVWVQFLYPQAESHLLPQNHLLLISEEKYIERFHIQITREDGDRVVIRNSSHLPRDRLAEDFVWAQWDLSEQRLYYIELKESRSILKCIQFRADESFNLMFEMPLDITLTGLRFKLVNFGYDYRQDREKLCNQPSLCIFTNHTGSLCMCYSPKSDSREEITYSVFYLHKGYRKIFTAAPGSADSQVTNGADSQVTDGIAFLNLGYFVAVYSPGHFLHLLNIQHPDLVCHSLFLTGNNKIAAVLPPSPLQSLPGSLVLDCYSGKVYRVTLDQSYLLRFLWNAHLDCERMAALHCILSCSQDPGFPEEQIIQWISEHVSACHSFDLIQEFLIASSYWSVYAELDDMGMLLQYSSVLTWNTEIPGIKFTTEELPLPLMKVYGLKGYWAKLNSNLEYIKYTKPHLHYHNSVVRREWHNLISEERTGKRRSTMYVRNILENAMKVIASMETRTLEPRLIPFLQEEDRHQRLLMGLMVSELRDHLLRHLQGVEKKKIEQMVLDYISKLLDLIWCLLETSWRKHSMHPLVLHLNSHCSAADFEVFHLMTRILDAASSLCLPLPPGFHSLHTILGVHCLPLYSLLHYIDNGVLLLTETAVTRLMKDLDNSEKNEQLKFSIIVRLPPLIGQKVCRLWDHPMSSNIISRNHVARLLKNYRKEPRNSMIDKSSFPVEFLPLNYFIEILMGLESSNQALYGFEGHDNVDAEFVEEAALKHTTMLLGL" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/45504", "id": "45504", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A4D1B5/", "id": "A4D1B5", "database": "OMA" } ], "common_name": "Mouse", "organism": "Mus musculus", "tax_id": 10090 } ], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "H", "subjects_tested": "50", "alt_nt": "C", "chr_id": "7", "ref_nt": "T", "chr_pos": "77010650", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "breast tumor" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "malignant neoplasm of breast" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "malignant tumor of the breast" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "mammary cancer" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "mammary tumor" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "primary breast cancer" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1612", "description": "A thoracic cancer that originates in the mammary gland.", "resource": "Disease Ontology", "id": "DOID:1612", "name": "breast cancer" } } ], "glycoeffect": [], "end_pos": 183, "frequency": "2.0", "sequence_mut": "R", "start_pos": 183, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D1B5", "id": "A4D1B5", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%)." }, { "sequence_org": "D", "subjects_tested": "50", "alt_nt": "A", "chr_id": "7", "ref_nt": "C", "chr_pos": "77006185", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "Thyroid gland neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant tumour of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid neoplasm" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1781", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage.", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid gland cancer" } } ], "glycoeffect": [], "end_pos": 241, "frequency": "2.0", "sequence_mut": "Y", "start_pos": 241, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D1B5", "id": "A4D1B5", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%)." }, { "sequence_org": "G", "subjects_tested": "129", "alt_nt": "T", "chr_id": "7", "ref_nt": "C", "chr_pos": "76991935", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "Thyroid gland neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant tumour of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid neoplasm" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1781", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage.", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid gland cancer" } }, { "synonyms": [], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:9256", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum.", "resource": "Disease Ontology", "id": "DOID:9256", "name": "colorectal cancer" } }, { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "breast tumor" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "malignant neoplasm of breast" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "malignant tumor of the breast" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "mammary cancer" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "mammary tumor" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "primary breast cancer" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1612", "description": "A thoracic cancer that originates in the mammary gland.", "resource": "Disease Ontology", "id": "DOID:1612", "name": "breast cancer" } } ], "glycoeffect": [], "end_pos": 305, "frequency": "0.8", "sequence_mut": "E", "start_pos": 305, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D1B5", "id": "A4D1B5", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3)." }, { "sequence_org": "A", "subjects_tested": "50", "alt_nt": "A", "chr_id": "7", "ref_nt": "G", "chr_pos": "76984570", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "breast tumor" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "malignant neoplasm of breast" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "malignant tumor of the breast" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "mammary cancer" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "mammary tumor" }, { "url": "http://disease-ontology.org/term/DOID:1612", "description": "", "resource": "Disease Ontology", "id": "DOID:1612", "name": "primary breast cancer" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1612", "description": "A thoracic cancer that originates in the mammary gland.", "resource": "Disease Ontology", "id": "DOID:1612", "name": "breast cancer" } } ], "glycoeffect": [], "end_pos": 433, "frequency": "2.0", "sequence_mut": "V", "start_pos": 433, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D1B5", "id": "A4D1B5", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%)." }, { "sequence_org": "G", "subjects_tested": "50", "alt_nt": "T", "chr_id": "7", "ref_nt": "C", "chr_pos": "76984552", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "Thyroid gland neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant tumour of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid neoplasm" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1781", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage.", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid gland cancer" } } ], "glycoeffect": [], "end_pos": 439, "frequency": "2.0", "sequence_mut": "D", "start_pos": 439, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D1B5", "id": "A4D1B5", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%)." }, { "sequence_org": "R", "subjects_tested": "93", "alt_nt": "A", "chr_id": "7", "ref_nt": "G", "chr_pos": "76955546", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:2394", "description": "", "resource": "Disease Ontology", "id": "DOID:2394", "name": "malignant Ovarian tumor" }, { "url": "http://disease-ontology.org/term/DOID:2394", "description": "", "resource": "Disease Ontology", "id": "DOID:2394", "name": "malignant tumour of ovary" }, { "url": "http://disease-ontology.org/term/DOID:2394", "description": "", "resource": "Disease Ontology", "id": "DOID:2394", "name": "ovarian neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:2394", "description": "", "resource": "Disease Ontology", "id": "DOID:2394", "name": "ovary neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:2394", "description": "", "resource": "Disease Ontology", "id": "DOID:2394", "name": "primary ovarian cancer" }, { "url": "http://disease-ontology.org/term/DOID:2394", "description": "", "resource": "Disease Ontology", "id": "DOID:2394", "name": "tumor of the Ovary" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:2394", "description": "A female reproductive organ cancer that is located_in the ovary.", "resource": "Disease Ontology", "id": "DOID:2394", "name": "ovarian cancer" } } ], "glycoeffect": [], "end_pos": 604, "frequency": "1.1", "sequence_mut": "W", "start_pos": 604, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D1B5", "id": "A4D1B5", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%). In dbSNP: rs570799989." }, { "sequence_org": "W", "subjects_tested": "66", "alt_nt": "A", "chr_id": "7", "ref_nt": "C", "chr_pos": "76950686", "disease": [ { "synonyms": [], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1324", "description": "A respiratory system cancer that is located_in the lung.", "resource": "Disease Ontology", "id": "DOID:1324", "name": "lung cancer" } } ], "glycoeffect": [], "end_pos": 653, "frequency": "1.5", "sequence_mut": "L", "start_pos": 653, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D1B5", "id": "A4D1B5", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.5%)." }, { "sequence_org": "G", "subjects_tested": "50", "alt_nt": "A", "chr_id": "7", "ref_nt": "C", "chr_pos": "77033908", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "Thyroid gland neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant tumour of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid neoplasm" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1781", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage.", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid gland cancer" } } ], "glycoeffect": [], "end_pos": 71, "frequency": "2.0", "sequence_mut": "*", "start_pos": 71, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D1B5", "id": "A4D1B5", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%)." } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "ac": "NP_059135.2", "name": "gamma-secretase-activating protein isoform a", "summary": "Accumulation of neurotoxic amyloid-beta is a major hallmark of Alzheimer disease (AD; MIM 104300). Formation of amyloid-beta is catalyzed by gamma-secretase (see PSEN1; MIM 104311), a protease with numerous substrates. PION, or GSAP, selectively increases amyloid-beta production through a mechanism involving its interaction with both gamma-secretase and its substrate, the amyloid-beta precursor protein (APP; MIM 104760) C-terminal fragment (APP-CTF) (He et al., 2010 [PubMed 20811458]).[supplied by OMIM, Nov 2010]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001540", "pmid": "20811458", "id": "GO:0001540", "name": "amyloid-beta binding", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D1B5", "id": "A4D1B5", "database": "UniProtKB" } ] } ], "total": 1, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005802", "pmid": "20811458", "id": "GO:0005802", "name": "trans-Golgi network", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D1B5", "id": "A4D1B5", "database": "UniProtKB" } ] } ], "total": 1, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902004", "pmid": "20811458", "id": "GO:1902004", "name": "positive regulation of amyloid-beta formation", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D1B5", "id": "A4D1B5", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030162", "pmid": "20811458", "id": "GO:0030162", "name": "regulation of proteolysis", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A4D1B5", "id": "A4D1B5", "database": "UniProtKB" } ] } ], "total": 2, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A4D1B5", "resource": "RefSeq", "type": "synonym", "name": "GSAP" }, { "url": "https://www.uniprot.org/uniprot/A4D1B5", "resource": "UniProtKB", "type": "recommended", "name": "GSAP" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A4D1B5", "resource": "RefSeq", "type": "synonym", "name": "PION" }, { "url": "https://www.uniprot.org/uniprot/A4D1B5", "resource": "UniProtKB", "type": "synonym", "name": "PION" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A4D1B5", "id": "A4D1B5", "database": "BioMuta" }, { "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3638343", "id": "CHEMBL3638343", "database": "ChEMBL" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GSAP", "id": "GSAP", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/54103", "id": "54103", "database": "GeneID" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=28042", "id": "28042", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A4D1B5*", "id": "A4D1B5", "database": "IntAct" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR026172", "id": "IPR026172", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR028010", "id": "IPR028010", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:54103", "id": "hsa:54103", "database": "KEGG Pathway" }, { "url": "http://www.omim.org/entry/613552", "id": "613552", "database": "MIM" }, { "url": "https://www.nextprot.org/entry/NX_A4D1B5", "id": "NX_A4D1B5", "database": "neXtProt" }, { "url": "https://omabrowser.org/oma/group/HEPCCHI/", "id": "HEPCCHI", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1035231at2759", "id": "1035231at2759", "database": "OrthoDB" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13630", "id": "PTHR13630", "database": "PANTHER" }, { "url": "http://pfam.xfam.org/family/PF14959", "id": "PF14959", "database": "Pfam" }, { "url": "https://pharos.nih.gov/targets/A4D1B5", "id": "A4D1B5", "database": "PHAROS" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A4D1B5", "id": "PR_A4D1B5", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_059135.2", "id": "NP_059135.2", "database": "RefSeq" } ], "expression_disease": [ { "name": "Prostate cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "NGP - new growth of prostate" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "hereditary prostate cancer" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "malignant tumor of the prostate" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostate cancer, familial" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostate neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostatic cancer" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostatic neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "tumor of the prostate" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:10283", "description": "A male reproductive organ cancer that is located_in the prostate.", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostate cancer" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A4D1B5", "id": "A4D1B5", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:10283", "significant": "Yes" }, { "name": "Urinary bladder cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:11054", "description": "", "resource": "Disease Ontology", "id": "DOID:11054", "name": "bladder cancer" }, { "url": "http://disease-ontology.org/term/DOID:11054", "description": "", "resource": "Disease Ontology", "id": "DOID:11054", "name": "tumor of the bladder" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:11054", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder.", "resource": "Disease Ontology", "id": "DOID:11054", "name": "urinary bladder cancer" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A4D1B5", "id": "A4D1B5", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:11054", "significant": "No" }, { "name": "Thyroid gland cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "Thyroid gland neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant tumour of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid neoplasm" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1781", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage.", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid gland cancer" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A4D1B5", "id": "A4D1B5", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:1781", "significant": "Yes" }, { "name": "Liver cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "Ca liver - primary" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "Resectable malignant neoplasm of Liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "hepatic cancer" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "hepatic neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant hepato-biliary neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant neoplasm of liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant neoplasm of liver, primary" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant tumor of liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "neoplasm of liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "primary liver cancer" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "primary malignant neoplasm of Liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "resectable malignant neoplasm of the liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:3571", "description": "A hepatobiliary system cancer that is located_in the liver.", "resource": "Disease Ontology", "id": "DOID:3571", "name": "liver cancer" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A4D1B5", "id": "A4D1B5", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3571", "significant": "No" }, { "name": "Lung squamous cell carcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:3907", "description": "", "resource": "Disease Ontology", "id": "DOID:3907", "name": "Epidermoid cell carcinoma of the lung" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:3907", "description": "A non-small cell lung carcinoma that has_material_basis_in the squamous cell.", "resource": "Disease Ontology", "id": "DOID:3907", "name": "lung squamous cell carcinoma" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A4D1B5", "id": "A4D1B5", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3907", "significant": "Yes" }, { "name": "Lung adenocarcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:3910", "description": "", "resource": "Disease Ontology", "id": "DOID:3910", "name": "bronchogenic lung adenocarcinoma" }, { "url": "http://disease-ontology.org/term/DOID:3910", "description": "", "resource": "Disease Ontology", "id": "DOID:3910", "name": "nonsmall cell adenocarcinoma" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:3910", "description": "A lung cancer that derives_from epithelial cells of glandular origin.", "resource": "Disease Ontology", "id": "DOID:3910", "name": "lung adenocarcinoma" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A4D1B5", "id": "A4D1B5", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3910", "significant": "No" }, { "name": "Esophageal cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "Ca lower third oesophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "Ca middle third oesophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "esophagus cancer" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of distal third of esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of lower third of oesophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of middle third of oesophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of proximal third of esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of upper third esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant tumor of Distal Third of esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant tumor of Proximal Third of esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant tumor of abdominal esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant tumor of the middle Third of the esophagus" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:5041", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "resource": "Disease Ontology", "id": "DOID:5041", "name": "esophageal cancer" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A4D1B5", "id": "A4D1B5", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:5041", "significant": "No" } ], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 97802.0, "chemical_mass": 97802.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000186088", "id": "ENSG00000186088", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A4D1B5", "name": "GSAP", "locus": { "chromosome": "7", "end_pos": 77310751, "start_pos": 77416400, "strand": "-", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000186088", "id": "ENSG00000186088", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A4D1B5", "resource": "UniProtKB", "type": "synonym", "name": "GSAP" }, { "url": "https://www.uniprot.org/uniprot/A4D1B5", "resource": "UniProtKB", "type": "recommended", "name": "Gamma-secretase-activating protein" }, { "url": "https://www.uniprot.org/uniprot/A4D1B5", "resource": "UniProtKB", "type": "synonym", "name": "Protein pigeon homolog" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A4D1B5", "resource": "RefSeq", "type": "synonym", "name": "gamma-secretase-activating protein isoform a" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A4D1B5", "resource": "RefSeq", "type": "synonym", "name": "protein pigeon homolog" } ] }