{
    "uniprot_canonical_ac": "A2RT31-1", 
    "ptm_annotation": [], 
    "sequence": {
        "header": "tr|A2RT31-1|A2RT31_MOUSE Isoform 1 of Olfactory receptor  OS=Mus musculus OX=10090 GN=Olfr110 PE=2 SV=1 CANONICAL=A2RT31-1", 
        "length": 317, 
        "sequence": "MEGKNQTAPSEFIILGFDHLNELQYLLFTIFFLTYICTLGGNVFIIVVTIADSHLHTPMYYFLGNLALIDICYTTTNVPQMMVHLLSEKKIISYGGCVTQLFAFIFFVGSECLLLAAMAYDRYIAICKPLRYSFIMNKALCSWLAASCWTGGFLNSVLHTVLTFHLPFCGNNQINYFFCDIPPLLILSCGDTSLNELALLSIGILIGWTPFLCVILSYLYIISTILRIRSSEGRHKAFSTCASHLLIVILYYGSAIFTYVRPISSYSLEKDRLISVLYSVVTPMLNPVIYTLRNKDIKEAVKAIGRKWQPPVFSSDI"
    }, 
    "uniprot_id": "A2RT31_MOUSE", 
    "enzyme_annotation": [], 
    "glycation": [], 
    "keywords": [], 
    "species": [
        {
            "common_name": "Mouse", 
            "taxid": 10090, 
            "name": "Mus musculus", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2RT31", 
                    "id": "A2RT31", 
                    "database": "UniProtKB"
                }
            ]
        }
    ], 
    "crossref_internal": {
        "gene": [
            "Olfr110"
        ], 
        "site": [
            "A2RT31-1.5.7"
        ], 
        "species": [
            10090
        ]
    }, 
    "publication": [
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/14506126", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "14506126"
                }
            ], 
            "title": "Co-duplication of olfactory receptor and MHC class I genes in the mouse major histocompatibility complex.", 
            "journal": "Human molecular genetics", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440.2", 
                    "id": "NP_666440.2", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Amadou C, Younger RM, Sims S, Matthews LH, Rogers J, Kumanovics A, Ziegler A, Beck S, Lindahl KF", 
            "date": "2003"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/29984401", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "29984401"
                }
            ], 
            "title": "Expression of the Cerebral Olfactory Receptors Olfr110/111 and Olfr544 Is Altered During Aging and in Alzheimer's Disease-Like Mice.", 
            "journal": "Molecular neurobiology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440.2", 
                    "id": "NP_666440.2", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Gaudel F, Stephan D, Landel V, Sicard G, Feron F, Guiraudie-Capraz G", 
            "date": "2019"
        }
    ], 
    "uniprot_ac": "A2RT31", 
    "site_annotation": [
        {
            "end_pos": 7, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 5
        }
    ], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A2RT31#A2RT31-1", 
            "isoform_ac": "A2RT31-1", 
            "sequence": {
                "header": "tr|A2RT31-1|A2RT31_MOUSE Isoform 1 of Olfactory receptor  OS=Mus musculus OX=10090 GN=Olfr110 PE=2 SV=1 CANONICAL=A2RT31-1", 
                "length": 317, 
                "sequence": "MEGKNQTAPSEFIILGFDHLNELQYLLFTIFFLTYICTLGGNVFIIVVTIADSHLHTPMYYFLGNLALIDICYTTTNVPQMMVHLLSEKKIISYGGCVTQLFAFIFFVGSECLLLAAMAYDRYIAICKPLRYSFIMNKALCSWLAASCWTGGFLNSVLHTVLTFHLPFCGNNQINYFFCDIPPLLILSCGDTSLNELALLSIGILIGWTPFLCVILSYLYIISTILRIRSSEGRHKAFSTCASHLLIVILYYGSAIFTYVRPISSYSLEKDRLISVLYSVVTPMLNPVIYTLRNKDIKEAVKAIGRKWQPPVFSSDI"
            }, 
            "locus": {
                "chromosome": "17", 
                "end_pos": 37498653, 
                "start_pos": 37499603, 
                "strand": "-", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUST00000216472", 
                        "id": "ENSMUST00000216472", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSP00000149213", 
                        "id": "ENSMUSP00000149213", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258325", 
            "resource": "KEGG Pathway", 
            "id": "mmu:258325", 
            "name": ""
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-381753", 
            "resource": "Reactome", 
            "id": "R-MMU-381753", 
            "name": "Olfactory Signaling Pathway"
        }
    ], 
    "function": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440.2", 
            "annotation": "Olfr110/111 and Olfr544 proteins are mainly expressed by neurons in cortical and hippocampal regions and, to a lesser extent, by glia and endothelial cells. expression of the mRNA encoding for Olfr110/111 tends to increase with age in both the cortex and hippocampus of wild-type and transgenic mice. Moreover, Olfr110/111 transcript expression is markedly impaired in the brain of Alzheimer's disease-like mice.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440.2", 
                    "id": "NP_666440.2", 
                    "database": "RefSeq"
                }
            ]
        }
    ], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q7TRK1-1", 
            "protein_name": "Olfactory receptor", 
            "sequence": {
                "length": 317, 
                "sequence": "MEGKNQTAPSEFIILGFDHLNELQYLLFTIFFLTYICTLGGNVFIIVVTIADSHLHTPMYYFLGNLALIDICYTTTNVPQMMVHLLSEKKIISYGGCVTQLFAFIFFVGSECLLLAAMAYDRYIAICKPLRYSFIMNKALCSWLAASCWTCGFLNSVLHTVLTFHLPFCGNNQINYFFCDIPPLLILSCGDTSLNELALLSIGILIGWTPFLCIILSYLYIISTILRIRSSEGRQKAFSTCASHLLIVILYYGSAIFTYVRPISSYSLEKDRLISVLYSVFTPMLNPIIYALRNKDIKEAVKAIGRKWQPPVFSSDM"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/73968", 
                    "id": "73968", 
                    "database": "MGI"
                }
            ], 
            "common_name": "Mouse", 
            "organism": "Mus musculus", 
            "tax_id": 10090
        }, 
        {
            "uniprot_canonical_ac": "Q9UGF6-1", 
            "protein_name": "Olfactory receptor 5V1", 
            "sequence": {
                "length": 321, 
                "sequence": "MERKNQTAITEFIILGFSNLNELQFLLFTIFFLTYFCTLGGNILIILTTVTDPHLHTPMYYFLGNLAFIDICYTTSNVPQMMVHLLSKKKSISYVGCVVQLFAFVFFVGSECLLLAAMAYDRYIAICNPLRYSVILSKVLCNQLAASCWAAGFLNSVVHTVLTFCLPFCGNNQINYFFCDIPPLLILSCGNTSVNELALLSTGVFIGWTPFLCIVLSYICIISTILRIQSSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEAVKTIGSKWQPPISSLDSKLTY"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/73968", 
                    "id": "73968", 
                    "database": "MGI"
                }
            ], 
            "common_name": "Human", 
            "organism": "Homo sapiens", 
            "tax_id": 9606
        }
    ], 
    "interactions": [], 
    "synthesized_glycans": [], 
    "snv": [], 
    "cluster_types": [
        {
            "name": "homologset.mgi", 
            "label": "MGI Homologs"
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440.2", 
        "ac": "NP_666440.2", 
        "name": "olfactory receptor 110", 
        "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]."
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", 
                        "pmid": "", 
                        "id": "GO:0004930", 
                        "name": "G protein-coupled receptor activity", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2RT31", 
                                "id": "A2RT31", 
                                "database": "UniProtKB"
                            }
                        ]
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", 
                        "pmid": "14611657", 
                        "id": "GO:0004984", 
                        "name": "olfactory receptor activity", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2RT31", 
                                "id": "A2RT31", 
                                "database": "UniProtKB"
                            }
                        ]
                    }
                ], 
                "total": 2, 
                "name": "Molecular Function"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", 
                        "pmid": "14611657", 
                        "id": "GO:0016021", 
                        "name": "integral component of membrane", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2RT31", 
                                "id": "A2RT31", 
                                "database": "UniProtKB"
                            }
                        ]
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", 
                        "pmid": "", 
                        "id": "GO:0005886", 
                        "name": "plasma membrane", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2RT31", 
                                "id": "A2RT31", 
                                "database": "UniProtKB"
                            }
                        ]
                    }
                ], 
                "total": 2, 
                "name": "Cellular Component"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", 
                        "pmid": "14611657", 
                        "id": "GO:0007186", 
                        "name": "G protein-coupled receptor signaling pathway", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2RT31", 
                                "id": "A2RT31", 
                                "database": "UniProtKB"
                            }
                        ]
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608", 
                        "pmid": "14611657", 
                        "id": "GO:0007608", 
                        "name": "sensory perception of smell", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2RT31", 
                                "id": "A2RT31", 
                                "database": "UniProtKB"
                            }
                        ]
                    }
                ], 
                "total": 2, 
                "name": "Biological Process"
            }
        ]
    }, 
    "gene_names": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2RT31", 
            "resource": "RefSeq", 
            "type": "synonym", 
            "name": "MOR249-2"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2RT31", 
            "resource": "RefSeq", 
            "type": "synonym", 
            "name": "Olfr110"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2RT31", 
            "resource": "UniProtKB", 
            "type": "recommended", 
            "name": "Olfr110"
        }
    ], 
    "pro_annotation": [], 
    "crossref": [
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000090894", 
            "id": "ENSMUSG00000090894", 
            "database": "Bgee"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/258325", 
            "id": "258325", 
            "database": "GeneID"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", 
            "id": "IPR000276", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", 
            "id": "IPR000725", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", 
            "id": "IPR017452", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258325", 
            "id": "mmu:258325", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "http://www.informatics.jax.org/marker/MGI:2177493", 
            "id": "2177493", 
            "database": "MGI"
        }, 
        {
            "url": "https://omabrowser.org/oma/group/SNVPQMM/", 
            "id": "SNVPQMM", 
            "database": "OMA"
        }, 
        {
            "url": "http://www.orthodb.org/?query=950898at2759", 
            "id": "950898at2759", 
            "database": "OrthoDB"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF13853", 
            "id": "PF13853", 
            "database": "Pfam"
        }, 
        {
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-381753", 
            "id": "R-MMU-381753", 
            "database": "Reactome"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666440.2", 
            "id": "NP_666440.2", 
            "database": "RefSeq"
        }
    ], 
    "expression_disease": [], 
    "glycosylation": [], 
    "mutagenesis": [], 
    "disease": [], 
    "phosphorylation": [], 
    "mass": {
        "monoisotopic_mass": 35760.0, 
        "chemical_mass": 35760.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A2RT31", 
            "name": "Olfr110", 
            "locus": {
                "chromosome": "17", 
                "end_pos": 37500207, 
                "start_pos": 37492468, 
                "strand": "+", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSG00000090894", 
                        "id": "ENSMUSG00000090894", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ], 
    "protein_names": [
        {
            "url": "https://www.uniprot.org/uniprot/A2RT31", 
            "resource": "UniProtKB", 
            "type": "recommended", 
            "name": "Olfactory receptor"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2RT31", 
            "resource": "RefSeq", 
            "type": "synonym", 
            "name": "olfactory receptor 110"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2RT31", 
            "resource": "RefSeq", 
            "type": "synonym", 
            "name": "olfactory receptor MOR249-2"
        }
    ]
}