{ "uniprot_canonical_ac": "A2AT78-1", "ptm_annotation": [], "sequence": { "header": "tr|A2AT78-1|A2AT78_MOUSE Isoform 1 of Olfactory receptor OS=Mus musculus OX=10090 GN=Olfr1247 PE=3 SV=1 CANONICAL=A2AT78-1", "length": 314, "sequence": "MGETNNVTEFVLLGLTQDPTGQKALFVMFLLMYIVTIVGNLLIVGTVIASPSLNSPMYFFLAFLSLMDAVYSTAILPKLLKDLVCDKKTISFTACLVQLFVEHLFGGAEVFLLVVMAYDRYVAICKPLHYLTVMNQQVCISLLVVAWVGGFAHALVQVLSVYKLPFCGPNVIDHFGCDMYPLLALVCTDTYFIGLTVVANNGAMCMVVFVLLLFSYGIILSSLKTHSQEGRRKALSTCSSHIMVVVLFFVPCIFMYVRPVSNFPIDKSISVFYTAITPMLNPLIYTLRNSEIKNSMGKLWSKMISIDRVRIFAY" }, "uniprot_id": "A2AT78_MOUSE", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Mouse", "taxid": 10090, "name": "Mus musculus", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AT78", "id": "A2AT78", "database": "UniProtKB" } ] } ], "crossref_internal": { "gene": [ "Olfr1247" ], "site": [ "A2AT78-1.6.8" ], "species": [ 10090 ] }, "publication": [], "uniprot_ac": "A2AT78", "site_annotation": [ { "end_pos": 8, "annotation": "n_glycosylation_sequon", "start_pos": 6 } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2AT78#A2AT78-1", "isoform_ac": "A2AT78-1", "sequence": { "header": "tr|A2AT78-1|A2AT78_MOUSE Isoform 1 of Olfactory receptor OS=Mus musculus OX=10090 GN=Olfr1247 PE=3 SV=1 CANONICAL=A2AT78-1", "length": 314, "sequence": "MGETNNVTEFVLLGLTQDPTGQKALFVMFLLMYIVTIVGNLLIVGTVIASPSLNSPMYFFLAFLSLMDAVYSTAILPKLLKDLVCDKKTISFTACLVQLFVEHLFGGAEVFLLVVMAYDRYVAICKPLHYLTVMNQQVCISLLVVAWVGGFAHALVQVLSVYKLPFCGPNVIDHFGCDMYPLLALVCTDTYFIGLTVVANNGAMCMVVFVLLLFSYGIILSSLKTHSQEGRRKALSTCSSHIMVVVLFFVPCIFMYVRPVSNFPIDKSISVFYTAITPMLNPLIYTLRNSEIKNSMGKLWSKMISIDRVRIFAY" }, "locus": { "chromosome": "2", "end_pos": 89609159, "start_pos": 89610100, "strand": "+", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000111532", "id": "ENSMUST00000111532", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000107157", "id": "ENSMUSP00000107157", "database": "Ensembl Peptide" } ] } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258968", "resource": "KEGG Pathway", "id": "mmu:258968", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-381753", "resource": "Reactome", "id": "R-MMU-381753", "name": "Olfactory Signaling Pathway" } ], "function": [], "orthologs": [], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667177.2", "ac": "NP_667177.2", "name": "olfactory receptor 1247", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "pmid": "", "id": "GO:0004930", "name": "G protein-coupled receptor activity", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AT78", "id": "A2AT78", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "pmid": "", "id": "GO:0004984", "name": "olfactory receptor activity", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AT78", "id": "A2AT78", "database": "UniProtKB" } ] } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "pmid": "", "id": "GO:0005886", "name": "plasma membrane", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AT78", "id": "A2AT78", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "pmid": "", "id": "GO:0016021", "name": "integral component of membrane", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AT78", "id": "A2AT78", "database": "UniProtKB" } ] } ], "total": 2, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "pmid": "21873635", "id": "GO:0007186", "name": "G protein-coupled receptor signaling pathway", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2AT78", "id": "A2AT78", "database": "UniProtKB" } ] } ], "total": 1, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AT78", "resource": "RefSeq", "type": "synonym", "name": "MOR231-6" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AT78", "resource": "RefSeq", "type": "synonym", "name": "Olfr1247" }, { "url": "https://www.uniprot.org/uniprot/A2AT78", "resource": "UniProtKB", "type": "recommended", "name": "Olfr1247" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000075081", "id": "ENSMUSG00000075081", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/258968", "id": "258968", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "id": "IPR000276", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "id": "IPR000725", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "id": "IPR017452", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258968", "id": "mmu:258968", "database": "KEGG Pathway" }, { "url": "http://www.informatics.jax.org/marker/MGI:3031081", "id": "3031081", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/ANNGAMC/", "id": "ANNGAMC", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=965113at2759", "id": "965113at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF13853", "id": "PF13853", "database": "Pfam" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-381753", "id": "R-MMU-381753", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_667177.2", "id": "NP_667177.2", "database": "RefSeq" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 34999.0, "chemical_mass": 34999.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2AT78", "name": "Olfr1247", "locus": { "chromosome": "2", "end_pos": 89604959, "start_pos": 89614130, "strand": "-", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000075081", "id": "ENSMUSG00000075081", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A2AT78", "resource": "UniProtKB", "type": "recommended", "name": "Olfactory receptor" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AT78", "resource": "RefSeq", "type": "synonym", "name": "olfactory receptor 1247" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2AT78", "resource": "RefSeq", "type": "synonym", "name": "olfactory receptor MOR231-6; GA_x6K02T2Q125-51051555-51050611" } ] }