{ "uniprot_canonical_ac": "A2ANU3-1", "ptm_annotation": [], "sequence": { "header": "sp|A2ANU3-1|SYNG1_MOUSE Isoform 1 of Synapse differentiation-inducing gene protein 1 OS=Mus musculus OX=10090 GN=Syndig1 PE=1 SV=1 CANONICAL=A2ANU3-1", "length": 258, "sequence": "MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSEPVQQLLDPNTLQQSVESHYRPNIILYSDGVLRSWGDGVATDCCETTFIEDRSPTKDSLEYPDGKFIDLSGDDIKIHTLSYDVEEEEELQELESDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLGIAAFYLSHETNKAVAKGDFHQASTSSRRALFLAVLSITIGTGIYVGVAVALIAYLSKNNHL" }, "uniprot_id": "SYNG1_MOUSE", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Mouse", "taxid": 10090, "name": "Mus musculus", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] } ], "crossref_internal": { "gene": [ "Syndig1" ], "site": [ "A2ANU3-1.137.137" ], "species": [ 10090 ] }, "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/12408845", "type": [ "PubMed" ], "id": "12408845" } ], "title": "Molecular analysis of gene expression in the developing pontocerebellar projection system.", "journal": "Neuron", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ], "authors": "Okazaki Y., Hayashizaki Y., Speed T.P., Ge Y., Scheiffele P., Diaz E., Yang Y.H., Loh K.C., Ngai J., Serafini T.A.", "date": "2002" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/20152115", "type": [ "PubMed" ], "id": "20152115" } ], "title": "SynDIG1: an activity-regulated, AMPA- receptor-interacting transmembrane protein that regulates excitatory synapse development.", "journal": "Neuron", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078990.1", "id": "NP_001078990.1", "database": "RefSeq" } ], "authors": "Li B., Kaur I., Ishimaru T., Trimmer J.S., Diaz E., Barisone G.A., Kalashnikova E., Lorca R.A., Mohapatra D.P.", "date": "2010" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/22363774", "type": [ "PubMed" ], "id": "22363774" } ], "title": "The dispanins: a novel gene family of ancient origin that contains 14 human members.", "journal": "PLoS ONE", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078990.1", "id": "NP_001078990.1", "database": "RefSeq" } ], "authors": "Fredriksson R., Schioth H.B., Bringeland N., Sallman Almen M.", "date": "2012" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27445135", "type": [ "PubMed" ], "id": "27445135" } ], "title": "Activity-Dependent Palmitoylation Controls SynDIG1 Stability, Localization, and Function.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078990.1", "id": "NP_001078990.1", "database": "RefSeq" } ], "authors": "Kaur I, Yarov-Yarovoy V, Kirk LM, Plambeck KE, Barragan EV, Ontiveros ES, Diaz E", "date": "2016" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27764765", "type": [ "PubMed" ], "id": "27764765" } ], "title": "Strain survey and genetic analysis of vasoreactivity in mouse aorta.", "journal": "Physiological genomics", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078990.1", "id": "NP_001078990.1", "database": "RefSeq" } ], "authors": "Kim SK, Avila JJ, Massett MP", "date": "2016" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27800545", "type": [ "PubMed" ], "id": "27800545" } ], "title": "Loss of SynDIG1 Reduces Excitatory Synapse Maturation But Not Formation In Vivo.", "journal": "eNeuro", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078990.1", "id": "NP_001078990.1", "database": "RefSeq" } ], "authors": "Chenaux G, Matt L, Hill TC, Kaur I, Liu XB, Kirk LM, Speca DJ, McMahon SA, Zito K, Hell JW, Diaz E", "date": "2016" } ], "uniprot_ac": "A2ANU3", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3#A2ANU3-1", "isoform_ac": "A2ANU3-1", "sequence": { "header": "sp|A2ANU3-1|SYNG1_MOUSE Isoform 1 of Synapse differentiation-inducing gene protein 1 OS=Mus musculus OX=10090 GN=Syndig1 PE=1 SV=1 CANONICAL=A2ANU3-1", "length": 258, "sequence": "MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSEPVQQLLDPNTLQQSVESHYRPNIILYSDGVLRSWGDGVATDCCETTFIEDRSPTKDSLEYPDGKFIDLSGDDIKIHTLSYDVEEEEELQELESDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLGIAAFYLSHETNKAVAKGDFHQASTSSRRALFLAVLSITIGTGIYVGVAVALIAYLSKNNHL" }, "locus": { "chromosome": "2", "end_pos": 149899496, "start_pos": 150003332, "strand": "-", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000109934", "id": "ENSMUST00000109934", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000105560", "id": "ENSMUSP00000105560", "database": "Ensembl Peptide" } ] } }, { "url": "https://www.uniprot.org/uniprot/A2ANU3#B1AYD3-1", "isoform_ac": "B1AYD3-1", "sequence": { "header": "tr|B1AYD3-1|SYNG1_MOUSE Computationally mapped isoform of Synapse differentiation-inducing gene protein 1 OS=Mus musculus OX=10090 GN=Syndig1 PE=1 SV=1 CANONICAL=A2ANU3-1", "length": 73, "sequence": "MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSEPVQQL" }, "locus": { "chromosome": "2", "end_pos": 149899496, "start_pos": 149899714, "strand": "-", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000144179", "id": "ENSMUST00000144179", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000116877", "id": "ENSMUSP00000116877", "database": "Ensembl Peptide" } ] } }, { "url": "https://www.uniprot.org/uniprot/A2ANU3#B1AYD4-1", "isoform_ac": "B1AYD4-1", "sequence": { "header": "tr|B1AYD4-1|SYNG1_MOUSE Computationally mapped isoform of Synapse differentiation-inducing gene protein 1 OS=Mus musculus OX=10090 GN=Syndig1 PE=1 SV=1 CANONICAL=A2ANU3-1", "length": 85, "sequence": "MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSEPVQQLLDPNTLQQSVES" }, "locus": { "chromosome": "2", "end_pos": 149899496, "start_pos": 149899750, "strand": "-", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000137280", "id": "ENSMUST00000137280", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000122838", "id": "ENSMUSP00000122838", "database": "Ensembl Peptide" } ] } }, { "url": "https://www.uniprot.org/uniprot/A2ANU3#B1AYD5-1", "isoform_ac": "B1AYD5-1", "sequence": { "header": "tr|B1AYD5-1|SYNG1_MOUSE Computationally mapped isoform of Synapse differentiation-inducing gene protein 1 OS=Mus musculus OX=10090 GN=Syndig1 PE=1 SV=1 CANONICAL=A2ANU3-1", "length": 86, "sequence": "MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSEPVQQLLDPNTLQQSVESH" }, "locus": { "chromosome": "2", "end_pos": 149899496, "start_pos": 149899753, "strand": "-", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000140870", "id": "ENSMUST00000140870", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000114499", "id": "ENSMUSP00000114499", "database": "Ensembl Peptide" } ] } }, { "url": "https://www.uniprot.org/uniprot/A2ANU3#B1AYD6-1", "isoform_ac": "B1AYD6-1", "sequence": { "header": "tr|B1AYD6-1|SYNG1_MOUSE Computationally mapped isoform of Synapse differentiation-inducing gene protein 1 OS=Mus musculus OX=10090 GN=Syndig1 PE=1 SV=8 CANONICAL=A2ANU3-1", "length": 128, "sequence": "MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSEPVQQLLDPNTLQQSVESHYRPNIILYSDGVLRSWGDGVATDCCETTFIEDRSPTKDSLEY" }, "locus": { "chromosome": "2", "end_pos": 149899496, "start_pos": 149899879, "strand": "-", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000149705", "id": "ENSMUST00000149705", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000122327", "id": "ENSMUSP00000122327", "database": "Ensembl Peptide" } ] } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:433485", "resource": "KEGG Pathway", "id": "mmu:433485", "name": "" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3#function", "annotation": "May regulate AMPA receptor content at nascent synapses, and have a role in postsynaptic development and maturation.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3#function", "id": "A2ANU3", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078990.1", "annotation": "Mice with reduced SynDIG1 exhibit deficits in the structure and function of excitatory synapses. Mature synapses are still present, albeit at a significantly reduced number, suggesting that synapses can reach maturity without SynDIG1. However, the overall reduction in the number of mature synapses by multiple criteria suggests that SynDIG1 is important for normal development. Publication Status: Online-Only", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078990.1", "id": "NP_001078990.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078990.1", "annotation": "This study provides mechanistic insight into SynDIG1 structure and function to demonstrate that its stability and subcellular localization are regulated by activity-dependent palmitoylation", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078990.1", "id": "NP_001078990.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q58DZ9-1", "protein_name": "Synapse differentiation-inducing gene protein 1", "sequence": { "length": 258, "sequence": "MDGIVEQKSVLVHSKIGDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSDPVQQLLDPNTLQQSVDSHYRPNIILYSDGVLRSWGDGVATDCCETTFIEDRSPTKDSLEYPDGKFIDLSGDDIKIHTLSYDVEEEEELQELESDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLGIAAFYLSHETNKAVAKGDFHQASTSSRRALFLAVLSITIGTGIYVGVAVALIAYLSKNNHL" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/11771", "id": "11771", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A2ANU3/", "id": "A2ANU3", "database": "OMA" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q9H7V2-1", "protein_name": "Synapse differentiation-inducing gene protein 1", "sequence": { "length": 258, "sequence": "MDGIIEQKSMLVHSKISDAGKRNGLINTRNLMAESRDGLVSVYPAPQYQSHRVGASTVPASLDSSRSEPMQQLLDPNTLQQSVESRYRPNIILYSEGVLRSWGDGVAADCCETTFIEDRSPTKDSLEYPDGKFIDLSADDIKIHTLSYDVEEEEEFQELESDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLGIAAFYLSHETNKAVAKGDLHQASTSSRRALFLAVLSITIGTGVYVGVAVALIAYLSKNNHL" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/11771", "id": "11771", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A2ANU3/", "id": "A2ANU3", "database": "OMA" } ], "common_name": "Human", "organism": "Homo sapiens", "tax_id": 9606 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078990.1", "ac": "NP_001078990.1", "name": "synapse differentiation-inducing gene protein 1", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "pmid": "20152115", "id": "GO:0042803", "name": "protein homodimerization activity", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035254", "pmid": "20152115", "id": "GO:0035254", "name": "glutamate receptor binding", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005887", "pmid": "20152115", "id": "GO:0005887", "name": "integral component of plasma membrane", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014069", "pmid": "20152115", "id": "GO:0014069", "name": "postsynaptic density", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031901", "pmid": "20152115", "id": "GO:0031901", "name": "early endosome membrane", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030054", "pmid": "", "id": "GO:0030054", "name": "cell junction", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043197", "pmid": "", "id": "GO:0043197", "name": "dendritic spine", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043198", "pmid": "", "id": "GO:0043198", "name": "dendritic shaft", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "pmid": "", "id": "GO:0043231", "name": "intracellular membrane-bounded organelle", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045211", "pmid": "", "id": "GO:0045211", "name": "postsynaptic membrane", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044297", "pmid": "", "id": "GO:0044297", "name": "cell body", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098793", "pmid": "", "id": "GO:0098793", "name": "presynapse", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060076", "pmid": "", "id": "GO:0060076", "name": "excitatory synapse", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] } ], "total": 11, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006886", "pmid": "20152115", "id": "GO:0006886", "name": "intracellular protein transport", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051965", "pmid": "20152115", "id": "GO:0051965", "name": "positive regulation of synapse assembly", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097091", "pmid": "", "id": "GO:0097091", "name": "synaptic vesicle clustering", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] } ], "total": 3, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A2ANU3", "resource": "RefSeq", "type": "synonym", "name": "AW123113; DSPC2; Gm14134; H2C20orf39; Tmem90b" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2ANU3", "resource": "RefSeq", "type": "synonym", "name": "Syndig1" }, { "url": "https://www.uniprot.org/uniprot/A2ANU3", "resource": "UniProtKB", "type": "recommended", "name": "Syndig1" }, { "url": "https://www.uniprot.org/uniprot/A2ANU3", "resource": "UniProtKB", "type": "synonym", "name": "Tmem90b" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000074736", "id": "ENSMUSG00000074736", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/433485", "id": "433485", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR007593", "id": "IPR007593", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:433485", "id": "mmu:433485", "database": "KEGG Pathway" }, { "url": "http://www.informatics.jax.org/marker/MGI:3702158", "id": "3702158", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/FLLMPPR/", "id": "FLLMPPR", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1273993at2759", "id": "1273993at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF04505", "id": "PF04505", "database": "Pfam" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A2ANU3", "id": "PR_A2ANU3", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001078990.1", "id": "NP_001078990.1", "database": "RefSeq" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [ { "residue": "Ser", "position": "137", "kinase_gene_name": "", "kinase_uniprot_canonical_ac": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "id": "A2ANU3", "database": "UniProtKB" } ] } ], "mass": { "monoisotopic_mass": 28456.0, "chemical_mass": 28456.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "name": "Syndig1", "locus": { "chromosome": "2", "end_pos": 150004392, "start_pos": 149829211, "strand": "+", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000074736", "id": "ENSMUSG00000074736", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A2ANU3", "resource": "UniProtKB", "type": "synonym", "name": "DSPC2" }, { "url": "https://www.uniprot.org/uniprot/A2ANU3", "resource": "UniProtKB", "type": "synonym", "name": "Dispanin subfamily C member 2" }, { "url": "https://www.uniprot.org/uniprot/A2ANU3", "resource": "UniProtKB", "type": "synonym", "name": "SynDIG1" }, { "url": "https://www.uniprot.org/uniprot/A2ANU3", "resource": "UniProtKB", "type": "recommended", "name": "Synapse differentiation-inducing gene protein 1" }, { "url": "https://www.uniprot.org/uniprot/A2ANU3", "resource": "UniProtKB", "type": "synonym", "name": "Transmembrane protein 90B" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2ANU3", "resource": "RefSeq", "type": "synonym", "name": "dispanin subfamily C member 2; transmembrane protein 90B" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2ANU3", "resource": "RefSeq", "type": "synonym", "name": "synapse differentiation-inducing gene protein 1" } ] }