{ "uniprot_canonical_ac": "A1L429-1", "ptm_annotation": [], "sequence": { "header": "sp|A1L429-1|GG12C_HUMAN Isoform 1 of G antigen 12B/C/D/E OS=Homo sapiens OX=9606 GN=GAGE12B PE=1 SV=1 CANONICAL=A1L429-1", "length": 117, "sequence": "MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC" }, "uniprot_id": "GG12C_HUMAN", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Human", "taxid": 9606, "name": "Homo sapiens", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L429", "id": "A1L429", "database": "UniProtKB" } ] } ], "crossref_internal": { "gene": [ "GAGE12B" ], "species": [ 9606 ], "disease": [ "DOID:3571", "DOID:1781", "DOID:10283", "DOID:3910", "DOID:11054", "DOID:3907", "DOID:5041" ], "site": [ "A1L429-1.13.13", "A1L429-1.114.114", "A1L429-1.9.9" ] }, "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/18179644", "type": [ "PubMed" ], "id": "18179644" } ], "title": "An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.", "journal": "Tissue Antigens", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L429", "id": "A1L429", "database": "UniProtKB" } ], "authors": "Ditzel H.J., Gjerstorff M.F.", "date": "2008" } ], "uniprot_ac": "A1L429", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1L429#A0A1Y8ELK0-1", "isoform_ac": "A0A1Y8ELK0-1", "sequence": { "header": "tr|A0A1Y8ELK0-1|GG12C_HUMAN Computationally mapped isoform of G antigen 12B/C/D/E OS=Homo sapiens OX=9606 GN=GAGE12B PE=1 SV=1 CANONICAL=A1L429-1", "length": 7, "sequence": "XEKQSQC" }, "locus": { "chromosome": "X", "end_pos": 49529869, "start_pos": 49529889, "strand": "-", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000361446", "id": "ENST00000361446", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000354603", "id": "ENSP00000354603", "database": "Ensembl Peptide" } ] } }, { "url": "https://www.uniprot.org/uniprot/A1L429#A1L429-1", "isoform_ac": "A1L429-1", "sequence": { "header": "sp|A1L429-1|GG12C_HUMAN Isoform 1 of G antigen 12B/C/D/E OS=Homo sapiens OX=9606 GN=GAGE12B PE=1 SV=1 CANONICAL=A1L429-1", "length": 117, "sequence": "MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC" }, "locus": { "chromosome": "X", "end_pos": 49552444, "start_pos": 49558552, "strand": "-", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000381698", "id": "ENST00000381698", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000371117", "id": "ENSP00000371117", "database": "Ensembl Peptide" } ] } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100132399", "resource": "KEGG Pathway", "id": "hsa:100132399", "name": "" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:729422", "resource": "KEGG Pathway", "id": "hsa:729422", "name": "" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:729428", "resource": "KEGG Pathway", "id": "hsa:729428", "name": "" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:729431", "resource": "KEGG Pathway", "id": "hsa:729431", "name": "" } ], "function": [], "orthologs": [ { "uniprot_canonical_ac": "A6NDE8-1", "protein_name": "G antigen 12H", "sequence": { "length": 117, "sequence": "MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQKGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/48022", "id": "48022", "database": "MGI" } ], "common_name": "Human", "organism": "Homo sapiens", "tax_id": 9606 }, { "uniprot_canonical_ac": "P0CL82-1", "protein_name": "G antigen 12I", "sequence": { "length": 117, "sequence": "MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/48022", "id": "48022", "database": "MGI" } ], "common_name": "Human", "organism": "Homo sapiens", "tax_id": 9606 }, { "uniprot_canonical_ac": "Q13065-1", "protein_name": "G antigen 1", "sequence": { "length": 117, "sequence": "MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEGQSQC" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/48022", "id": "48022", "database": "MGI" } ], "common_name": "Human", "organism": "Homo sapiens", "tax_id": 9606 }, { "uniprot_canonical_ac": "Q13066-1", "protein_name": "G antigen 2B/2C", "sequence": { "length": 116, "sequence": "MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/48022", "id": "48022", "database": "MGI" } ], "common_name": "Human", "organism": "Homo sapiens", "tax_id": 9606 }, { "uniprot_canonical_ac": "Q6NT46-1", "protein_name": "G antigen 2A", "sequence": { "length": 116, "sequence": "MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGQDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/48022", "id": "48022", "database": "MGI" } ], "common_name": "Human", "organism": "Homo sapiens", "tax_id": 9606 }, { "uniprot_canonical_ac": "Q9UEU5-1", "protein_name": "G antigen 2D", "sequence": { "length": 116, "sequence": "MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/48022", "id": "48022", "database": "MGI" } ], "common_name": "Human", "organism": "Homo sapiens", "tax_id": 9606 } ], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "Q", "subjects_tested": "50", "alt_nt": "A", "chr_id": "X", "ref_nt": "C", "chr_pos": "49323144", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "Thyroid gland neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant tumour of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid neoplasm" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1781", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage.", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid gland cancer" } } ], "glycoeffect": [], "end_pos": 114, "frequency": "2.0", "sequence_mut": "K", "start_pos": 114, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L429", "id": "A1L429", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%)." }, { "sequence_org": "R", "subjects_tested": "50", "alt_nt": "T", "chr_id": "X", "ref_nt": "A", "chr_pos": "49297973", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "Thyroid gland neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant tumour of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid neoplasm" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1781", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage.", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid gland cancer" } } ], "glycoeffect": [], "end_pos": 13, "frequency": "2.0", "sequence_mut": "S", "start_pos": 13, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L429", "id": "A1L429", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%)." }, { "sequence_org": "Y", "subjects_tested": "50", "alt_nt": "G", "chr_id": "X", "ref_nt": "A", "chr_pos": "49297960", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "Thyroid gland neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "malignant tumour of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "neoplasm of thyroid gland" }, { "url": "http://disease-ontology.org/term/DOID:1781", "description": "", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid neoplasm" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:1781", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage.", "resource": "Disease Ontology", "id": "DOID:1781", "name": "thyroid gland cancer" } } ], "glycoeffect": [ "o-glyco-site-loss" ], "end_pos": 9, "frequency": "2.0", "sequence_mut": "C", "start_pos": 9, "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "subjects_positive": "1", "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L429", "id": "A1L429", "database": "BioMuta" } ], "minor_allelic_frequency": "", "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%)." } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": {}, "go_annotation": {}, "gene_names": [ { "url": "https://www.uniprot.org/uniprot/A1L429", "resource": "UniProtKB", "type": "recommended", "name": "GAGE12B" }, { "url": "https://www.uniprot.org/uniprot/A1L429", "resource": "UniProtKB", "type": "recommended", "name": "GAGE12C" }, { "url": "https://www.uniprot.org/uniprot/A1L429", "resource": "UniProtKB", "type": "recommended", "name": "GAGE12D" }, { "url": "https://www.uniprot.org/uniprot/A1L429", "resource": "UniProtKB", "type": "recommended", "name": "GAGE12E" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1L429", "id": "A1L429", "database": "BioMuta" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GAGE12B", "id": "GAGE12B", "database": "GeneCards" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GAGE12C", "id": "GAGE12C", "database": "GeneCards" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GAGE12D", "id": "GAGE12D", "database": "GeneCards" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GAGE12E", "id": "GAGE12E", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/100132399", "id": "100132399", "database": "GeneID" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/729422", "id": "729422", "database": "GeneID" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/729428", "id": "729428", "database": "GeneID" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/729431", "id": "729431", "database": "GeneID" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=26779", "id": "26779", "database": "HGNC" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=28402", "id": "28402", "database": "HGNC" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=31904", "id": "31904", "database": "HGNC" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=31905", "id": "31905", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A1L429*", "id": "A1L429", "database": "IntAct" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR008625", "id": "IPR008625", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR031320", "id": "IPR031320", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:100132399", "id": "hsa:100132399", "database": "KEGG Pathway" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:729422", "id": "hsa:729422", "database": "KEGG Pathway" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:729428", "id": "hsa:729428", "database": "KEGG Pathway" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:729431", "id": "hsa:729431", "database": "KEGG Pathway" }, { "url": "http://www.omim.org/entry/300727", "id": "300727", "database": "MIM" }, { "url": "http://www.omim.org/entry/300728", "id": "300728", "database": "MIM" }, { "url": "http://www.omim.org/entry/300729", "id": "300729", "database": "MIM" }, { "url": "https://www.nextprot.org/entry/NX_A1L429", "id": "NX_A1L429", "database": "neXtProt" }, { "url": "http://www.orthodb.org/?query=1575904at2759", "id": "1575904at2759", "database": "OrthoDB" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14047", "id": "PTHR14047", "database": "PANTHER" }, { "url": "http://pfam.xfam.org/family/PF05831", "id": "PF05831", "database": "Pfam" }, { "url": "https://pharos.nih.gov/targets/A1L429", "id": "A1L429", "database": "PHAROS" }, { "url": "http://research.bioinformatics.udel.edu/pro/entry/PR_A1L429", "id": "PR_A1L429", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120817.1", "id": "NP_001120817.1", "database": "RefSeq" } ], "expression_disease": [ { "name": "Prostate cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "NGP - new growth of prostate" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "hereditary prostate cancer" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "malignant tumor of the prostate" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostate cancer, familial" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostate neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostatic cancer" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostatic neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:10283", "description": "", "resource": "Disease Ontology", "id": "DOID:10283", "name": "tumor of the prostate" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:10283", "description": "A male reproductive organ cancer that is located_in the prostate.", "resource": "Disease Ontology", "id": "DOID:10283", "name": "prostate cancer" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L429", "id": "A1L429", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:10283", "significant": "No" }, { "name": "Urinary bladder cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:11054", "description": "", "resource": "Disease Ontology", "id": "DOID:11054", "name": "bladder cancer" }, { "url": "http://disease-ontology.org/term/DOID:11054", "description": "", "resource": "Disease Ontology", "id": "DOID:11054", "name": "tumor of the bladder" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:11054", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder.", "resource": "Disease Ontology", "id": "DOID:11054", "name": "urinary bladder cancer" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L429", "id": "A1L429", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:11054", "significant": "No" }, { "name": "Liver cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "Ca liver - primary" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "Resectable malignant neoplasm of Liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "hepatic cancer" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "hepatic neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant hepato-biliary neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant neoplasm of liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant neoplasm of liver, primary" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant tumor of liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "neoplasm of liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "primary liver cancer" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "primary malignant neoplasm of Liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "resectable malignant neoplasm of the liver" }, { "url": "http://disease-ontology.org/term/DOID:3571", "description": "", "resource": "Disease Ontology", "id": "DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:3571", "description": "A hepatobiliary system cancer that is located_in the liver.", "resource": "Disease Ontology", "id": "DOID:3571", "name": "liver cancer" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L429", "id": "A1L429", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3571", "significant": "No" }, { "name": "Lung squamous cell carcinoma [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:3907", "description": "", "resource": "Disease Ontology", "id": "DOID:3907", "name": "Epidermoid cell carcinoma of the lung" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:3907", "description": "A non-small cell lung carcinoma that has_material_basis_in the squamous cell.", "resource": "Disease Ontology", "id": "DOID:3907", "name": "lung squamous cell carcinoma" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L429", "id": "A1L429", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3907", "significant": "No" }, { "name": "Lung adenocarcinoma [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:3910", "description": "", "resource": "Disease Ontology", "id": "DOID:3910", "name": "bronchogenic lung adenocarcinoma" }, { "url": "http://disease-ontology.org/term/DOID:3910", "description": "", "resource": "Disease Ontology", "id": "DOID:3910", "name": "nonsmall cell adenocarcinoma" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:3910", "description": "A lung cancer that derives_from epithelial cells of glandular origin.", "resource": "Disease Ontology", "id": "DOID:3910", "name": "lung adenocarcinoma" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L429", "id": "A1L429", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3910", "significant": "No" }, { "name": "Esophageal cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "Ca lower third oesophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "Ca middle third oesophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "esophagus cancer" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of distal third of esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of lower third of oesophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of middle third of oesophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of proximal third of esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant neoplasm of upper third esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant tumor of Distal Third of esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant tumor of Proximal Third of esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant tumor of abdominal esophagus" }, { "url": "http://disease-ontology.org/term/DOID:5041", "description": "", "resource": "Disease Ontology", "id": "DOID:5041", "name": "malignant tumor of the middle Third of the esophagus" } ], "recommended_name": { "url": "http://disease-ontology.org/term/DOID:5041", "description": "A gastrointestinal system cancer that is located_in the esophagus.", "resource": "Disease Ontology", "id": "DOID:5041", "name": "esophageal cancer" } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1L429", "id": "A1L429", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:5041", "significant": "Yes" } ], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 12925.0, "chemical_mass": 12925.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000216649", "id": "ENSG00000216649", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1L429", "name": "GAGE12B", "locus": { "chromosome": "X", "end_pos": 49529985, "start_pos": 49529869, "strand": "+", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000236737", "id": "ENSG00000236737", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L429", "resource": "RefSeq", "type": "synonym", "name": "G antigen 12B/C/D/E" }, { "url": "https://www.uniprot.org/uniprot/A1L429", "resource": "UniProtKB", "type": "recommended", "name": "G antigen 12B/C/D/E" }, { "url": "https://www.uniprot.org/uniprot/A1L429", "resource": "UniProtKB", "type": "synonym", "name": "GAGE-12B" }, { "url": "https://www.uniprot.org/uniprot/A1L429", "resource": "UniProtKB", "type": "synonym", "name": "GAGE-12C" }, { "url": "https://www.uniprot.org/uniprot/A1L429", "resource": "UniProtKB", "type": "synonym", "name": "GAGE-12D" }, { "url": "https://www.uniprot.org/uniprot/A1L429", "resource": "UniProtKB", "type": "synonym", "name": "GAGE-12E" } ] }