{ "uniprot_canonical_ac": "A5LHX3-1", "ptm_annotation": [], "sequence": { "header": "sp|A5LHX3-1|PSB11_HUMAN Isoform 1 of Proteasome subunit beta type-11 OS=Homo sapiens OX=9606 GN=PSMB11 PE=1 SV=1 CANONICAL=A5LHX3-1", "length": 300, "sequence": "MALQDVCKWQSPDTQGPSPHLPRAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELSVGPGEVTPGDSRMPAGTETV" }, "uniprot_id": "PSB11_HUMAN", "enzyme_annotation": [ { "ec": "3.4.25.1", "activity": "" }, { "ec": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity." } ], "glycation": [], "keywords": [], "species": [ { "common_name": "Human", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/11285280", "type": [ "PubMed" ], "id": "11285280" } ], "title": "Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.", "journal": "The Journal of cell biology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Geley S, Kramer E, Gieffers C, Gannon J, Peters JM, Hunt T", "date": "2001" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/12791267", "type": [ "PubMed" ], "id": "12791267" } ], "title": "Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.", "journal": "Developmental cell", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Margottin-Goguet F, Hsu JY, Loktev A, Hsieh HM, Reimann JD, Jackson PK", "date": "2003" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/17540904", "type": [ "PubMed" ], "id": "17540904" } ], "title": "Regulation of CD8+ T cell development by thymus-specific proteasomes.", "journal": "Science", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Hayashi H., Tanaka K., Kishimoto T., Sasaki K., Murata S., Niwa S., Takahama Y.", "date": "2007" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/19289856", "type": [ "PubMed" ], "id": "19289856" } ], "title": "Exclusive expression of proteasome subunit {beta}5t in the human thymic cortex.", "journal": "Blood", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Tomaru U, Ishizu A, Murata S, Miyatake Y, Suzuki S, Takahashi S, Kazamaki T, Ohara J, Baba T, Iwasaki S, Fugo K, Otsuka N, Tanaka K, Kasahara M", "date": "2009" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21836487", "type": [ "PubMed" ], "id": "21836487" } ], "title": "Expression of proteasome subunit beta5t in thymic epithelial tumors.", "journal": "The American journal of surgical pathology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Yamada Y, Tomaru U, Ishizu A, Kiuchi T, Marukawa K, Matsuno Y, Kasahara M", "date": "2011" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21941364", "type": [ "PubMed" ], "id": "21941364" } ], "title": "Impaired bortezomib binding to mutant beta5 subunit of the proteasome is the underlying basis for bortezomib resistance in leukemia cells.", "journal": "Leukemia", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Franke NE, Niewerth D, Assaraf YG, van Meerloo J, Vojtekova K, van Zantwijk CH, Zweegman S, Chan ET, Kirk CJ, Geerke DP, Schimmer AD, Kaspers GJ, Jansen G, Cloos J", "date": "2012" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/24293611", "type": [ "PubMed" ], "id": "24293611" } ], "title": "Expression of thymoproteasome subunit beta5t in type AB thymoma.", "journal": "Journal of clinical pathology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Yamada Y, Tomaru U, Ishizu A, Kiuchi T, Kasahara M, Matsuno Y", "date": "2014" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/25556590", "type": [ "PubMed" ], "id": "25556590" } ], "title": "Decreased expression of thymus-specific proteasome subunit beta5t in Down syndrome patients.", "journal": "Histopathology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ], "authors": "Tomaru U, Tsuji T, Kiuchi S, Ishizu A, Suzuki A, Otsuka N, Ito T, Ikeda H, Fukasawa Y, Kasahara M", "date": "2015" } ], "uniprot_ac": "A5LHX3", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3#A5LHX3-1", "isoform_ac": "A5LHX3-1", "locus": { "end_pos": 23042226, "strand": "-", "start_pos": 23043125, "chromosome": "14", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000408907", "id": "ENST00000408907", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000386212", "id": "ENSP00000386212", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A5LHX3-1|PSB11_HUMAN Isoform 1 of Proteasome subunit beta type-11 OS=Homo sapiens OX=9606 GN=PSMB11 PE=1 SV=1 CANONICAL=A5LHX3-1", "length": 300, "sequence": "MALQDVCKWQSPDTQGPSPHLPRAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEHVSRSDACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELSVGPGEVTPGDSRMPAGTETV" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:122706", "resource": "KEGG Pathway", "id": "hsa:122706", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091", "resource": "Reactome", "id": "R-HSA-1169091", "name": "Activation of NF-kappaB in B cells" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176", "resource": "Reactome", "id": "R-HSA-1234176", "name": "Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974", "resource": "Reactome", "id": "R-HSA-1236974", "name": "ER-Phagosome pathway" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236978", "resource": "Reactome", "id": "R-HSA-1236978", "name": "Cross-presentation of soluble exogenous antigens (endosomes)" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174113", "resource": "Reactome", "id": "R-HSA-174113", "name": "SCF-beta-TrCP mediated degradation of Emi1" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174154", "resource": "Reactome", "id": "R-HSA-174154", "name": "APC/C:Cdc20 mediated degradation of Securin" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178", "resource": "Reactome", "id": "R-HSA-174178", "name": "APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174184", "resource": "Reactome", "id": "R-HSA-174184", "name": "Cdc20:Phospho-APC/C mediated degradation of Cyclin A" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180534", "resource": "Reactome", "id": "R-HSA-180534", "name": "Vpu mediated degradation of CD4" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180585", "resource": "Reactome", "id": "R-HSA-180585", "name": "Vif-mediated degradation of APOBEC3G" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253", "resource": "Reactome", "id": "R-HSA-195253", "name": "Degradation of beta-catenin by the destruction complex" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424", "resource": "Reactome", "id": "R-HSA-202424", "name": "Downstream TCR signaling" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211733", "resource": "Reactome", "id": "R-HSA-211733", "name": "Regulation of activated PAK-2p34 by proteasome mediated degradation" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813", "resource": "Reactome", "id": "R-HSA-2467813", "name": "Separation of Sister Chromatids" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837", "resource": "Reactome", "id": "R-HSA-2871837", "name": "FCERI mediated NF-kB activation" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-349425", "resource": "Reactome", "id": "R-HSA-349425", "name": "Autodegradation of the E3 ubiquitin ligase COP1" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562", "resource": "Reactome", "id": "R-HSA-350562", "name": "Regulation of ornithine decarboxylase (ODC)" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556", "resource": "Reactome", "id": "R-HSA-382556", "name": "ABC-family proteins mediated transport" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408", "resource": "Reactome", "id": "R-HSA-450408", "name": "AUF1 (hnRNP D0) binds and destabilizes mRNA" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4608870", "resource": "Reactome", "id": "R-HSA-4608870", "name": "Asymmetric localization of PCP proteins" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641257", "resource": "Reactome", "id": "R-HSA-4641257", "name": "Degradation of AXIN" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641258", "resource": "Reactome", "id": "R-HSA-4641258", "name": "Degradation of DVL" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346", "resource": "Reactome", "id": "R-HSA-5358346", "name": "Hedgehog ligand biogenesis" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362768", "resource": "Reactome", "id": "R-HSA-5362768", "name": "Hh mutants that don't undergo autocatalytic processing are degraded by ERAD" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761", "resource": "Reactome", "id": "R-HSA-5607761", "name": "Dectin-1 mediated noncanonical NF-kB signaling" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764", "resource": "Reactome", "id": "R-HSA-5607764", "name": "CLEC7A (Dectin-1) signaling" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610780", "resource": "Reactome", "id": "R-HSA-5610780", "name": "Degradation of GLI1 by the proteasome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610783", "resource": "Reactome", "id": "R-HSA-5610783", "name": "Degradation of GLI2 by the proteasome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610785", "resource": "Reactome", "id": "R-HSA-5610785", "name": "GLI3 is processed to GLI3R by the proteasome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684", "resource": "Reactome", "id": "R-HSA-5632684", "name": "Hedgehog 'on' state" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442", "resource": "Reactome", "id": "R-HSA-5658442", "name": "Regulation of RAS by GAPs" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541", "resource": "Reactome", "id": "R-HSA-5668541", "name": "TNFR2 non-canonical NF-kB pathway" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676590", "resource": "Reactome", "id": "R-HSA-5676590", "name": "NIK-->noncanonical NF-kB signaling" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895", "resource": "Reactome", "id": "R-HSA-5678895", "name": "Defective CFTR causes cystic fibrosis" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128", "resource": "Reactome", "id": "R-HSA-5687128", "name": "MAPK6/MAPK4 signaling" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603", "resource": "Reactome", "id": "R-HSA-5689603", "name": "UCH proteinases" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880", "resource": "Reactome", "id": "R-HSA-5689880", "name": "Ub-specific processing proteases" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68827", "resource": "Reactome", "id": "R-HSA-68827", "name": "CDT1 association with the CDC6:ORC:origin complex" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68949", "resource": "Reactome", "id": "R-HSA-68949", "name": "Orc1 removal from chromatin" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017", "resource": "Reactome", "id": "R-HSA-69017", "name": "CDK-mediated phosphorylation and removal of Cdc6" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69481", "resource": "Reactome", "id": "R-HSA-69481", "name": "G2/M Checkpoints" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69601", "resource": "Reactome", "id": "R-HSA-69601", "name": "Ubiquitin Mediated Degradation of Phosphorylated Cdc25A" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815", "resource": "Reactome", "id": "R-HSA-75815", "name": "Ubiquitin-dependent degradation of Cyclin D" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276", "resource": "Reactome", "id": "R-HSA-8852276", "name": "The role of GTSE1 in G2/M progression after G2 checkpoint" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8854050", "resource": "Reactome", "id": "R-HSA-8854050", "name": "FBXL7 down-regulates AURKA during mitotic entry and in early mitosis" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236", "resource": "Reactome", "id": "R-HSA-8939236", "name": "RUNX1 regulates transcription of genes involved in differentiation of HSCs" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902", "resource": "Reactome", "id": "R-HSA-8939902", "name": "Regulation of RUNX2 expression and activity" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751", "resource": "Reactome", "id": "R-HSA-8948751", "name": "Regulation of PTEN stability and activity" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664", "resource": "Reactome", "id": "R-HSA-8951664", "name": "Neddylation" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553", "resource": "Reactome", "id": "R-HSA-9010553", "name": "Regulation of expression of SLITs and ROBOs" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702", "resource": "Reactome", "id": "R-HSA-9020702", "name": "Interleukin-1 signaling" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168", "resource": "Reactome", "id": "R-HSA-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation" } ], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "annotation": "Histological diversity of type AB thymoma correlates with expression of a functional marker beta5t and abundance of TdT-positive lymphocytes.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "annotation": "Human beta5t was expressed in approximately 80% of cortical thymic epithelial cells and some cortical dendritic cells", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "annotation": "Proteasome beta5t is expressed in most type B and in some type AB thymomas and is a marker useful in differentiating type B3 thymomas from thymic carcinomas when used in combination with other diagnostic markers.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "annotation": "Provide the first evidence that the mechanism underlying BTZ resistance in these tumor cells is impaired binding of BTZ to the mutant beta5 subunit of the proteasome", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "annotation": "Results suggest a key role for beta5t in generating the MHC class I-restricted CD8(+) T cell repertoire during thymic selection", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ] }, { "url": "https://www.uniprot.org/uniprot/A5LHX3#function", "annotation": "The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Incorporated instead of PSMB5 or PSMB8, this unit reduces the chymotrypsin-like activity of the proteasome (By similarity). Plays a pivotal role in development of CD8-positive T cells (By similarity).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3#function", "id": "A5LHX3", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "annotation": "We analysed thymic tissues from patients with trisomy 13 (n = 4), trisomy 18 (n = 14) and trisomy 21 (n = 13) for histological alterations, and for the expression of functionally important molecules such as beta5t, a thymoproteasome subunit, and cathepsins.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "M0R7C4-1", "protein_name": "Proteasome subunit beta", "sequence": { "length": 301, "sequence": "MALQDVCKWQAPDTHGLSLRLPQAGGWAVPRGCDPQTFLQIYGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASRKVIPVHRHLLGTTSGTSADCATWYRVLRRELRLRELREGQLPSVAGTAKLLSAMMSRYRGLDLCVATALCGWDHSGPALFYVYSDGTCLQGDVFSVGSGSPYAYGVLDRSYHYDMTVQEAYTLARCAVAHATHRDAYSGGSVDLFHVRESGWEYISRSDACVLYRELQEAQGFEQELEAKASEVLPEPATPQDARESELSVELEEVTPEDCKIIVKTETM" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/13729", "id": "13729", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A5LHX3/", "id": "A5LHX3", "database": "OMA" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "gene_name": "Psmb11", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q8BG41-1", "protein_name": "Proteasome subunit beta type-11", "sequence": { "length": 302, "sequence": "MALQDVCKWQTPDTPRPSIHLPQAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHGVIAAADTRSSCGSYVACPASRKVIPVHQRLLGTTSGTSADCATWYRVLRRELRLRELREGQLPSVAGTAKLLAAMMSCYRGLDLCVATALCGWDHSGPALFYVYSDGTCLQGDIFSVGSGSPYAYGVLDRGYHYDMTIQEAYTLARCAVAHATHRDAYSGGSVDLFHVRESGWEYVSRSDACVLYRELQKARSLEQELEAKACGIYPEPATPQGARECKELFVEQEEVTPEDCAIIMKTETM" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/13729", "id": "13729", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A5LHX3/", "id": "A5LHX3", "database": "OMA" } ], "common_name": "Mouse", "organism": "Mus musculus", "gene_name": "Psmb11", "tax_id": 10090 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "ac": "NP_001093250.1", "name": "proteasome subunit beta type-11", "summary": "Proteasomes generate peptides that are presented by major histocompatibility complex (MHC) I molecules to other cells of the immune system. Proteolysis is conducted by 20S proteasomes, complexes of 28 subunits arranged as a cylinder in 4 heteroheptameric rings: alpha-1 to -7, beta-1 to -7, beta-1 to -7, and alpha-1 to -7. The catalytic subunits are beta-1 (PSMB6; MIM 600307), beta-2 (PSMB7; MIM 604030), and beta-5 (PSMB5; MIM 600306). Three additional subunits, beta-1i (PSMB9; MIM 177045), beta-2i (PSMB10; MIM 176847), and beta-5i (PSMB8; MIM 177046), are induced by gamma-interferon (IFNG; MIM 147570) and are preferentially incorporated into proteasomes to make immunoproteasomes. PSMB11, or beta-5t, is a catalytic subunit expressed exclusively in cortical thymic epithelial cells (Murata et al., 2007 [PubMed 17540904]).[supplied by OMIM, Mar 2008]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004175", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "endopeptidase activity", "id": "GO:0004175" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008233", "pmid": "17540904", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "peptidase activity", "id": "GO:0008233" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004298", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "threonine-type endopeptidase activity", "id": "GO:0004298" } ], "total": 3, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005839", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "proteasome core complex", "id": "GO:0005839" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019774", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "proteasome core complex, beta-subunit complex", "id": "GO:0019774" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "cytosol", "id": "GO:0005829" } ], "total": 5, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "pmid": "17540904", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "proteolysis", "id": "GO:0006508" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010498", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "proteasomal protein catabolic process", "id": "GO:0010498" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010499", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "proteasomal ubiquitin-independent protein catabolic process", "id": "GO:0010499" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070498", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "interleukin-1-mediated signaling pathway", "id": "GO:0070498" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043374", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "CD8-positive, alpha-beta T cell differentiation", "id": "GO:0043374" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016579", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "protein deubiquitination", "id": "GO:0016579" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043687", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "post-translational protein modification", "id": "GO:0043687" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055085", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "transmembrane transport", "id": "GO:0055085" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090090", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "negative regulation of canonical Wnt signaling pathway", "id": "GO:0090090" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000165", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "MAPK cascade", "id": "GO:0000165" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043488", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "regulation of mRNA stability", "id": "GO:0043488" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050852", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "T cell receptor signaling pathway", "id": "GO:0050852" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002479", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent", "id": "GO:0002479" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902036", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "regulation of hematopoietic stem cell differentiation", "id": "GO:1902036" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031145", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "anaphase-promoting complex-dependent catabolic process", "id": "GO:0031145" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060071", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "Wnt signaling pathway, planar cell polarity pathway", "id": "GO:0060071" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090263", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "positive regulation of canonical Wnt signaling pathway", "id": "GO:0090263" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000209", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "protein polyubiquitination", "id": "GO:0000209" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033077", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "T cell differentiation in thymus", "id": "GO:0033077" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033209", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "tumor necrosis factor-mediated signaling pathway", "id": "GO:0033209" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038061", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "NIK/NF-kappaB signaling", "id": "GO:0038061" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061418", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "regulation of transcription from RNA polymerase II promoter in response to hypoxia", "id": "GO:0061418" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901990", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "regulation of mitotic cell cycle phase transition", "id": "GO:1901990" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002223", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "stimulatory C-type lectin receptor signaling pathway", "id": "GO:0002223" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010972", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "negative regulation of G2/M transition of mitotic cell cycle", "id": "GO:0010972" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038095", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "Fc-epsilon receptor signaling pathway", "id": "GO:0038095" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006521", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "regulation of cellular amino acid metabolic process", "id": "GO:0006521" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031146", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "name": "SCF-dependent proteasomal ubiquitin-dependent protein catabolic process", "id": "GO:0031146" } ], "total": 29, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A5LHX3", "type": "synonym", "resource": "RefSeq", "name": "BETA5T" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A5LHX3", "type": "synonym", "resource": "RefSeq", "name": "PSMB11" }, { "url": "https://www.uniprot.org/uniprot/A5LHX3", "type": "recommended", "resource": "UniProtKB", "name": "PSMB11" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A5LHX3", "id": "A5LHX3", "database": "BioMuta" }, { "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2364701", "id": "CHEMBL2364701", "database": "ChEMBL" }, { "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3831201", "id": "CHEMBL3831201", "database": "ChEMBL" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PSMB11", "id": "PSMB11", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/122706", "id": "122706", "database": "GeneID" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=31963", "id": "31963", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A5LHX3*", "id": "A5LHX3", "database": "IntAct" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000243", "id": "IPR000243", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR001353", "id": "IPR001353", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR016050", "id": "IPR016050", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR023333", "id": "IPR023333", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR029055", "id": "IPR029055", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR034385", "id": "IPR034385", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:122706", "id": "hsa:122706", "database": "KEGG Pathway" }, { "url": "http://www.omim.org/entry/611137", "id": "611137", "database": "MIM" }, { "url": "https://www.nextprot.org/entry/NX_A5LHX3", "id": "NX_A5LHX3", "database": "neXtProt" }, { "url": "https://omabrowser.org/oma/group/VCKWQAP/", "id": "VCKWQAP", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=929961at2759", "id": "929961at2759", "database": "OrthoDB" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11599:SF48", "id": "PTHR11599:SF48", "database": "PANTHER" }, { "url": "http://pfam.xfam.org/family/PF00227", "id": "PF00227", "database": "Pfam" }, { "url": "https://pharos.nih.gov/targets/A5LHX3", "id": "A5LHX3", "database": "PHAROS" }, { "url": "http://purl.obolibrary.org/obo/PR_PR_A5LHX3", "id": "PR_A5LHX3", "database": "PRO" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169091", "id": "R-HSA-1169091", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1234176", "id": "R-HSA-1234176", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236974", "id": "R-HSA-1236974", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1236978", "id": "R-HSA-1236978", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174113", "id": "R-HSA-174113", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174154", "id": "R-HSA-174154", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174178", "id": "R-HSA-174178", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174184", "id": "R-HSA-174184", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180534", "id": "R-HSA-180534", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180585", "id": "R-HSA-180585", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-195253", "id": "R-HSA-195253", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202424", "id": "R-HSA-202424", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-211733", "id": "R-HSA-211733", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813", "id": "R-HSA-2467813", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2871837", "id": "R-HSA-2871837", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-349425", "id": "R-HSA-349425", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-350562", "id": "R-HSA-350562", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-382556", "id": "R-HSA-382556", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450408", "id": "R-HSA-450408", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4608870", "id": "R-HSA-4608870", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641257", "id": "R-HSA-4641257", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4641258", "id": "R-HSA-4641258", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5358346", "id": "R-HSA-5358346", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362768", "id": "R-HSA-5362768", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607761", "id": "R-HSA-5607761", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5607764", "id": "R-HSA-5607764", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610780", "id": "R-HSA-5610780", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610783", "id": "R-HSA-5610783", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5610785", "id": "R-HSA-5610785", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5632684", "id": "R-HSA-5632684", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5658442", "id": "R-HSA-5658442", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541", "id": "R-HSA-5668541", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676590", "id": "R-HSA-5676590", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5678895", "id": "R-HSA-5678895", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128", "id": "R-HSA-5687128", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689603", "id": "R-HSA-5689603", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5689880", "id": "R-HSA-5689880", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68827", "id": "R-HSA-68827", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68949", "id": "R-HSA-68949", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69017", "id": "R-HSA-69017", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69481", "id": "R-HSA-69481", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69601", "id": "R-HSA-69601", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75815", "id": "R-HSA-75815", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8852276", "id": "R-HSA-8852276", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8854050", "id": "R-HSA-8854050", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939236", "id": "R-HSA-8939236", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939902", "id": "R-HSA-8939902", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8948751", "id": "R-HSA-8948751", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8951664", "id": "R-HSA-8951664", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9010553", "id": "R-HSA-9010553", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9020702", "id": "R-HSA-9020702", "database": "Reactome" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-983168", "id": "R-HSA-983168", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001093250.1", "id": "NP_001093250.1", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A5LHX3", "id": "A5LHX3", "database": "UniProtKB" } ], "expression_disease": [ { "name": "Prostate cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "tumor of the prostate", "description": "" } ], "recommended_name": { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5LHX3", "id": "A5LHX3", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:10283", "significant": "No" }, { "name": "Urinary bladder cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5LHX3", "id": "A5LHX3", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:11054", "significant": "No" }, { "name": "Thyroid gland cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5LHX3", "id": "A5LHX3", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:1781", "significant": "No" }, { "name": "Liver cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "recommended_name": { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5LHX3", "id": "A5LHX3", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3571", "significant": "No" }, { "name": "Lung squamous cell carcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "Epidermoid cell carcinoma of the lung", "description": "" } ], "recommended_name": { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "lung squamous cell carcinoma", "description": "A non-small cell lung carcinoma that has_material_basis_in the squamous cell." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5LHX3", "id": "A5LHX3", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3907", "significant": "No" }, { "name": "Lung adenocarcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "bronchogenic lung adenocarcinoma", "description": "" }, { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "nonsmall cell adenocarcinoma", "description": "" } ], "recommended_name": { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "lung adenocarcinoma", "description": "A lung cancer that derives_from epithelial cells of glandular origin." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5LHX3", "id": "A5LHX3", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3910", "significant": "No" }, { "name": "Esophageal cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of the middle Third of the esophagus", "description": "" } ], "recommended_name": { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A5LHX3", "id": "A5LHX3", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:5041", "significant": "No" } ], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 32530.0, "chemical_mass": 32530.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000222028", "id": "ENSG00000222028", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3", "name": "PSMB11", "locus": { "end_pos": 23044276, "strand": "+", "start_pos": 23042167, "chromosome": "14", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000222028", "id": "ENSG00000222028", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A5LHX3#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "3.4.25.1" }, { "url": "https://www.uniprot.org/uniprot/A5LHX3#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "Proteasome subunit beta type-11" }, { "url": "https://www.uniprot.org/uniprot/A5LHX3#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Proteasome subunit beta-5t" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A5LHX3", "type": "synonym", "resource": "RefSeq", "name": "proteasome subunit beta 5T; proteasome (prosome, macropain) subunit, beta type, 11; proteasome subunit beta-5t" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A5LHX3", "type": "synonym", "resource": "RefSeq", "name": "proteasome subunit beta type-11" } ] }