{ "uniprot_canonical_ac": "A2RRD8-1", "ptm_annotation": [], "sequence": { "header": "sp|A2RRD8-1|ZN320_HUMAN Isoform 1 of Zinc finger protein 320 OS=Homo sapiens OX=9606 GN=ZNF320 PE=1 SV=1 CANONICAL=A2RRD8-1", "length": 509, "sequence": "MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMNTLSSTGQGNTEVIHTGTLQRQASYHIGAFCSQEIEKDIHDFVFQWQEDETNDHEAPMTEIKKLTSSTDRYDQRHAGNKPIKGQLESRFHLHLRRHRRIHTGEKPYKCEECEKVFSCKSHLEIHRIIHTGEKPYKCKVCDKAFKHDSHLAKHTRIHRGDKHYTCNECGKVFDQKATLACHHRSHTGEKPYKCNECGKTFSQTSHLVYHHRLHTGEKPYKCNECGKTFARNSVLVIHKAVHTAEKPYKCNECGKVFKQRATLAGHRRVHTGEKPYRCEECDKVFSRKSHLERHRRIHTGEKPYKCKVCDKAFRSDSRLAEHQRVHTGERPYTCNECGKVFSTKAYLACHQKLHTGEKLYECEECDKVYIRKSHLERHRRIHTGEKPHKCGDCGKAFNSPSHLIRHQRIHTGQKSYKCHQCGKVFSLRSLLAEHQKIPFGDNCFKCNEYSKPSSIN" }, "uniprot_id": "ZN320_HUMAN", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Human", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RRD8", "id": "A2RRD8", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/11536051", "type": [ "PubMed" ], "id": "11536051" } ], "title": "A novel member of the WD-repeat gene family, WDR11, maps to the 10q26 region and is disrupted by a chromosome translocation in human glioblastoma cells.", "journal": "Oncogene", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RRD8", "id": "A2RRD8", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997216.2", "id": "NP_997216.2", "database": "RefSeq" } ], "authors": "Malaj E., Pan H., Cowell J.K., Roe B., Chernova O.B., Crooks C., Hunyadi A.", "date": "2001" } ], "uniprot_ac": "A2RRD8", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2RRD8#A0A669KBJ2-1", "isoform_ac": "A0A669KBJ2-1", "locus": { "end_pos": 52864032, "strand": "+", "start_pos": 52890255, "chromosome": "19", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000673631", "id": "ENST00000673631", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000500974", "id": "ENSP00000500974", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A669KBJ2-1|ZN320_HUMAN Computationally mapped isoform of Zinc finger protein 320 OS=Homo sapiens OX=9606 GN=ZNF320 PE=1 SV=1 CANONICAL=A2RRD8-1", "length": 117, "sequence": "MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLGLISRDLCYLRKTPRRQRKGARDGSSSGILDFQRCGYRVLFAGVETPGPCTERFIQGCDVGELQEPGVCG" } }, { "url": "https://www.uniprot.org/uniprot/A2RRD8#A2RRD8-1", "isoform_ac": "A2RRD8-1", "locus": { "end_pos": 52880599, "strand": "+", "start_pos": 52890255, "chromosome": "19", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000595635", "id": "ENST00000595635", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000473091", "id": "ENSP00000473091", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A2RRD8-1|ZN320_HUMAN Isoform 1 of Zinc finger protein 320 OS=Homo sapiens OX=9606 GN=ZNF320 PE=1 SV=1 CANONICAL=A2RRD8-1", "length": 509, "sequence": "MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMNTLSSTGQGNTEVIHTGTLQRQASYHIGAFCSQEIEKDIHDFVFQWQEDETNDHEAPMTEIKKLTSSTDRYDQRHAGNKPIKGQLESRFHLHLRRHRRIHTGEKPYKCEECEKVFSCKSHLEIHRIIHTGEKPYKCKVCDKAFKHDSHLAKHTRIHRGDKHYTCNECGKVFDQKATLACHHRSHTGEKPYKCNECGKTFSQTSHLVYHHRLHTGEKPYKCNECGKTFARNSVLVIHKAVHTAEKPYKCNECGKVFKQRATLAGHRRVHTGEKPYRCEECDKVFSRKSHLERHRRIHTGEKPYKCKVCDKAFRSDSRLAEHQRVHTGERPYTCNECGKVFSTKAYLACHQKLHTGEKLYECEECDKVYIRKSHLERHRRIHTGEKPHKCGDCGKAFNSPSHLIRHQRIHTGQKSYKCHQCGKVFSLRSLLAEHQKIPFGDNCFKCNEYSKPSSIN" } }, { "url": "https://www.uniprot.org/uniprot/A2RRD8#M0QX96-1", "isoform_ac": "M0QX96-1", "locus": { "end_pos": 52881619, "strand": "+", "start_pos": 52890255, "chromosome": "19", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000597091", "id": "ENST00000597091", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000468995", "id": "ENSP00000468995", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|M0QX96-1|ZN320_HUMAN Computationally mapped isoform of Zinc finger protein 320 OS=Homo sapiens OX=9606 GN=ZNF320 PE=1 SV=1 CANONICAL=A2RRD8-1", "length": 155, "sequence": "MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLGQGNTEVIHTGTLQRQASYHIGAFCSQEIEKDIHDFVFQWQEDETNDHEAPMTEIKKLTSSTDRYDQRHAGNKPIKGQLESRFHLHLRRHRRIHTGEKPYKCEECEKV" } }, { "url": "https://www.uniprot.org/uniprot/A2RRD8#M0QZA2-1", "isoform_ac": "M0QZA2-1", "locus": { "end_pos": 52881868, "strand": "+", "start_pos": 52890255, "chromosome": "19", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000594741", "id": "ENST00000594741", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000470403", "id": "ENSP00000470403", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|M0QZA2-1|ZN320_HUMAN Computationally mapped isoform of Zinc finger protein 320 OS=Homo sapiens OX=9606 GN=ZNF320 PE=1 SV=1 CANONICAL=A2RRD8-1", "length": 86, "sequence": "MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMNTLSSTGQGNTEVIHTGTLQRQASYHIGAFC" } }, { "url": "https://www.uniprot.org/uniprot/A2RRD8#M0R0Z8-1", "isoform_ac": "M0R0Z8-1", "locus": { "end_pos": 52888194, "strand": "+", "start_pos": 52890255, "chromosome": "19", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000597111", "id": "ENST00000597111", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000471548", "id": "ENSP00000471548", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|M0R0Z8-1|ZN320_HUMAN Computationally mapped isoform of Zinc finger protein 320 OS=Homo sapiens OX=9606 GN=ZNF320 PE=1 SV=1 CANONICAL=A2RRD8-1", "length": 25, "sequence": "MALSQGLLTFRDVAIEFSQEEWKCL" } }, { "url": "https://www.uniprot.org/uniprot/A2RRD8#M0R1K6-1", "isoform_ac": "M0R1K6-1", "locus": { "end_pos": 52881955, "strand": "+", "start_pos": 52890255, "chromosome": "19", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000597265", "id": "ENST00000597265", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000471938", "id": "ENSP00000471938", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|M0R1K6-1|ZN320_HUMAN Computationally mapped isoform of Zinc finger protein 320 OS=Homo sapiens OX=9606 GN=ZNF320 PE=1 SV=1 CANONICAL=A2RRD8-1", "length": 57, "sequence": "MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMNT" } }, { "url": "https://www.uniprot.org/uniprot/A2RRD8#M0R2L4-1", "isoform_ac": "M0R2L4-1", "locus": { "end_pos": 52881757, "strand": "+", "start_pos": 52890255, "chromosome": "19", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000593618", "id": "ENST00000593618", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000472651", "id": "ENSP00000472651", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|M0R2L4-1|ZN320_HUMAN Computationally mapped isoform of Zinc finger protein 320 OS=Homo sapiens OX=9606 GN=ZNF320 PE=1 SV=1 CANONICAL=A2RRD8-1", "length": 123, "sequence": "MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMNTLSSTGQGNTEVIHTGTLQRQASYHIGAFCSQEIEKDIHDFVFQWQEDETNDHEAPMTEIKKLTSST" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:162967", "resource": "KEGG Pathway", "id": "hsa:162967", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212436", "resource": "Reactome", "id": "R-HSA-212436", "name": "Generic Transcription Pathway" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A2RRD8#function", "annotation": "May be involved in transcriptional regulation.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RRD8#function", "id": "A2RRD8", "database": "UniProtKB" } ] } ], "orthologs": [], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "D", "start_pos": 124, "alt_nt": "G", "chr_id": "19", "ref_nt": "C", "chr_pos": "53385009", "disease": [ { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2RRD8", "id": "A2RRD8", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "1.0", "sequence_mut": "H", "subjects_tested": "103", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.0%).", "end_pos": 124, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "G", "start_pos": 138, "alt_nt": "T", "chr_id": "19", "ref_nt": "C", "chr_pos": "53384967", "disease": [ { "synonyms": [ { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "malignant Ovarian tumor", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "malignant tumour of ovary", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "ovarian neoplasm", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "ovary neoplasm", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "primary ovarian cancer", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "tumor of the Ovary", "description": "" } ], "recommended_name": { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2RRD8", "id": "A2RRD8", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "1.1", "sequence_mut": "S", "subjects_tested": "93", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%). In dbSNP: rs748742438.", "end_pos": 138, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "F", "start_pos": 17, "alt_nt": "T", "chr_id": "19", "ref_nt": "G", "chr_pos": "53391471", "disease": [ { "synonyms": [], "recommended_name": { "id": "DOID:9256", "url": "http://disease-ontology.org/term/DOID:9256", "resource": "Disease Ontology", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2RRD8", "id": "A2RRD8", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "1.1", "sequence_mut": "L", "subjects_tested": "94", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%).", "end_pos": 17, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "L", "start_pos": 344, "alt_nt": "C", "chr_id": "19", "ref_nt": "G", "chr_pos": "53384349", "disease": [ { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2RRD8", "id": "A2RRD8", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "1.0", "sequence_mut": "V", "subjects_tested": "103", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.0%).", "end_pos": 344, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "R", "start_pos": 424, "alt_nt": "T", "chr_id": "19", "ref_nt": "C", "chr_pos": "53384108", "disease": [ { "synonyms": [ { "id": "DOID:10534", "url": "http://disease-ontology.org/term/DOID:10534", "resource": "Disease Ontology", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "url": "http://disease-ontology.org/term/DOID:10534", "resource": "Disease Ontology", "name": "gastric neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:10534", "url": "http://disease-ontology.org/term/DOID:10534", "resource": "Disease Ontology", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." } }, { "synonyms": [ { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "primary breast cancer", "description": "" } ], "recommended_name": { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." } }, { "synonyms": [ { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "tumor of the Brain", "description": "" } ], "recommended_name": { "id": "DOID:1319", "url": "http://disease-ontology.org/term/DOID:1319", "resource": "Disease Ontology", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." } }, { "synonyms": [ { "id": "DOID:4362", "url": "http://disease-ontology.org/term/DOID:4362", "resource": "Disease Ontology", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "url": "http://disease-ontology.org/term/DOID:4362", "resource": "Disease Ontology", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "url": "http://disease-ontology.org/term/DOID:4362", "resource": "Disease Ontology", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "url": "http://disease-ontology.org/term/DOID:4362", "resource": "Disease Ontology", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "url": "http://disease-ontology.org/term/DOID:4362", "resource": "Disease Ontology", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "url": "http://disease-ontology.org/term/DOID:4362", "resource": "Disease Ontology", "name": "uterine cervical neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:4362", "url": "http://disease-ontology.org/term/DOID:4362", "resource": "Disease Ontology", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2RRD8", "id": "A2RRD8", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "0.2", "sequence_mut": "H", "subjects_tested": "1044", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: num. of cancers (4).", "end_pos": 424, "minor_allelic_frequency": "", "subjects_positive": "2" }, { "sequence_org": "Q", "start_pos": 473, "alt_nt": "T", "chr_id": "19", "ref_nt": "G", "chr_pos": "53383962", "disease": [ { "synonyms": [ { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "malignant Ovarian tumor", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "malignant tumour of ovary", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "ovarian neoplasm", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "ovary neoplasm", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "primary ovarian cancer", "description": "" }, { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "tumor of the Ovary", "description": "" } ], "recommended_name": { "id": "DOID:2394", "url": "http://disease-ontology.org/term/DOID:2394", "resource": "Disease Ontology", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2RRD8", "id": "A2RRD8", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "1.1", "sequence_mut": "K", "subjects_tested": "93", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%).", "end_pos": 473, "minor_allelic_frequency": "", "subjects_positive": "1" } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997216.2", "ac": "NP_997216.2", "name": "zinc finger protein 320 isoform 1", "summary": "ZNF320 encodes a Kruppel-like zinc finger protein. Members of this protein family are involved in activation or repression of transcription.[supplied by OMIM, Jul 2002]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RRD8", "id": "A2RRD8", "database": "UniProtKB" } ], "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RRD8", "id": "A2RRD8", "database": "UniProtKB" } ], "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RRD8", "id": "A2RRD8", "database": "UniProtKB" } ], "name": "metal ion binding", "id": "GO:0046872" } ], "total": 3, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RRD8", "id": "A2RRD8", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" } ], "total": 1, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2RRD8", "id": "A2RRD8", "database": "UniProtKB" } ], "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357" } ], "total": 1, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RRD8", "type": "synonym", "resource": "RefSeq", "name": "ZFPL" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RRD8", "type": "synonym", "resource": "RefSeq", "name": "ZNF320" }, { "url": "https://www.uniprot.org/uniprot/A2RRD8", "type": "recommended", "resource": "UniProtKB", "name": "ZNF320" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2RRD8", "id": "A2RRD8", "database": "BioMuta" }, { "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07765", "id": "cd07765", "database": "CDD" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ZNF320", "id": "ZNF320", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/162967", "id": "162967", "database": "GeneID" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=13842", "id": "13842", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A2RRD8*", "id": "A2RRD8", "database": "IntAct" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR001909", "id": "IPR001909", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "id": "IPR013087", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036051", "id": "IPR036051", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "id": "IPR036236", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:162967", "id": "hsa:162967", "database": "KEGG Pathway" }, { "url": "http://www.omim.org/entry/606427", "id": "606427", "database": "MIM" }, { "url": "https://www.nextprot.org/entry/NX_A2RRD8", "id": "NX_A2RRD8", "database": "neXtProt" }, { "url": "https://omabrowser.org/oma/group/YHIGALC/", "id": "YHIGALC", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1318335at2759", "id": "1318335at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF00096", "id": "PF00096", "database": "Pfam" }, { "url": "http://pfam.xfam.org/family/PF01352", "id": "PF01352", "database": "Pfam" }, { "url": "https://pharos.nih.gov/targets/A2RRD8", "id": "A2RRD8", "database": "PHAROS" }, { "url": "http://purl.obolibrary.org/obo/PR_PR_A2RRD8", "id": "PR_A2RRD8", "database": "PRO" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-212436", "id": "R-HSA-212436", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997216.2", "id": "NP_997216.2", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A2RRD8", "id": "A2RRD8", "database": "UniProtKB" } ], "expression_disease": [ { "name": "Prostate cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "tumor of the prostate", "description": "" } ], "recommended_name": { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RRD8", "id": "A2RRD8", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:10283", "significant": "No" }, { "name": "Urinary bladder cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RRD8", "id": "A2RRD8", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:11054", "significant": "No" }, { "name": "Thyroid gland cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RRD8", "id": "A2RRD8", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:1781", "significant": "No" }, { "name": "Liver cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "recommended_name": { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RRD8", "id": "A2RRD8", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3571", "significant": "No" }, { "name": "Lung squamous cell carcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "Epidermoid cell carcinoma of the lung", "description": "" } ], "recommended_name": { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "lung squamous cell carcinoma", "description": "A non-small cell lung carcinoma that has_material_basis_in the squamous cell." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RRD8", "id": "A2RRD8", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3907", "significant": "No" }, { "name": "Lung adenocarcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "bronchogenic lung adenocarcinoma", "description": "" }, { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "nonsmall cell adenocarcinoma", "description": "" } ], "recommended_name": { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "lung adenocarcinoma", "description": "A lung cancer that derives_from epithelial cells of glandular origin." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RRD8", "id": "A2RRD8", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3910", "significant": "No" }, { "name": "Esophageal cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of the middle Third of the esophagus", "description": "" } ], "recommended_name": { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2RRD8", "id": "A2RRD8", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:5041", "significant": "No" } ], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 59326.0, "chemical_mass": 59326.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000182986", "id": "ENSG00000182986", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2RRD8", "name": "ZNF320", "locus": { "end_pos": 52863790, "strand": "-", "start_pos": 52897693, "chromosome": "19", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000182986", "id": "ENSG00000182986", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A2RRD8#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "Zinc finger protein 320" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RRD8", "type": "synonym", "resource": "RefSeq", "name": "zinc finger protein 320 isoform 1" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2RRD8", "type": "synonym", "resource": "RefSeq", "name": "zinc finger protein like; zinc finger gene 320" } ] }