{
    "uniprot_canonical_ac": "A2AGA4-1", 
    "ptm_annotation": [
        {
            "annotation": "Proteolytic processing of the proenzyme produces an N- and a C-terminal fragment. The processing is required for activation of the protease (By similarity).", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2AGA4", 
                    "id": "A2AGA4", 
                    "database": "UniProtKB"
                }, 
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/", 
                    "id": "", 
                    "database": "PubMed"
                }
            ]
        }
    ], 
    "sequence": {
        "header": "sp|A2AGA4-1|RHBL2_MOUSE Isoform 1 of Rhomboid-related protein 2  OS=Mus musculus OX=10090 GN=Rhbdl2 PE=1 SV=1 CANONICAL=A2AGA4-1", 
        "length": 302, 
        "sequence": "MAVAHEMEMESVNLNMEREGKEEPEEEKMKGNGEGKDFPRSRKVHRIVSKWMLPEPVRRTYLERANCLPPPLFIILISLAELAVFIYYAVWKPQKQWITLDTGILESPLTYCPEKREEAWRFISYMLVHAGVQHIVGNLLMQIVLGIPLEMVHKGLRVGLVYLAGVLAGSLASSIFDPLKSLVGASGGVYALMGGYFMNVIVNFREMIPAFGIVRLLVIILIVASDMGFALYRRFFVPANGSPVSFAAHIAGGFAGMSIGYTVFSCFDKTLLKDPRFWIAIAAYVACLLFAVFFNIFLSPAN"
    }, 
    "uniprot_id": "RHBL2_MOUSE", 
    "enzyme_annotation": [
        {
            "ec": "3.4.21.105", 
            "activity": ""
        }, 
        {
            "ec": "3.4.21.105", 
            "activity": "Cleaves type-1 transmembrane domains using a catalytic dyad composed of serine and histidine that are contributed by different transmembrane domains."
        }
    ], 
    "glycation": [], 
    "keywords": [], 
    "species": [
        {
            "common_name": "Mouse", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2AGA4", 
                    "id": "A2AGA4", 
                    "database": "UniProtKB"
                }
            ], 
            "name": "Mus musculus", 
            "taxid": 10090
        }
    ], 
    "publication": [
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/21439629", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "21439629"
                }
            ], 
            "title": "Rhomboid family pseudoproteases use the ER quality control machinery to regulate intercellular signaling.", 
            "journal": "Cell", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2AGA4", 
                    "id": "A2AGA4", 
                    "database": "UniProtKB"
                }
            ], 
            "authors": "Freeman M., Adrain C., Lastun V., Strisovsky K., Zettl M.", 
            "date": "2011"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/21833011", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "21833011"
                }
            ], 
            "title": "Functions of rhomboid family protease RHBDL2 and thrombomodulin in wound healing.", 
            "journal": "The Journal of investigative dermatology", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_898986.2", 
                    "id": "NP_898986.2", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Cheng TL, Wu YT, Lin HY, Hsu FC, Liu SK, Chang BI, Chen WS, Lai CH, Shi GY, Wu HL", 
            "date": "2011"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/24194600", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "24194600"
                }
            ], 
            "title": "The International Mouse Phenotyping Consortium Web Portal, a unified point of access for knockout mice and related phenotyping data.", 
            "journal": "Nucleic acids research", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_898986.2", 
                    "id": "NP_898986.2", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Koscielny G, Yaikhom G, Iyer V, Meehan TF, Morgan H, Atienza-Herrero J, Blake A, Chen CK, Easty R, Di Fenza A, Fiegel T, Grifiths M, Horne A, Karp NA, Kurbatova N, Mason JC, Matthews P, Oakley DJ, Qazi A, Regnart J, Retha A, Santos LA, Sneddon DJ, Warren J, Westerberg H, Wilson RJ, Melvin DG, Smedley D, Brown SD, Flicek P, Skarnes WC, Mallon AM, Parkinson H", 
            "date": "2014"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/27626380", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "27626380"
                }
            ], 
            "title": "High-throughput discovery of novel developmental phenotypes.", 
            "journal": "Nature", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_898986.2", 
                    "id": "NP_898986.2", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Dickinson ME, Flenniken AM, Ji X, Teboul L, Wong MD, White JK, Meehan TF, Weninger WJ, Westerberg H, Adissu H, Baker CN, Bower L, Brown JM, Caddle LB, Chiani F, Clary D, Cleak J, Daly MJ, Denegre JM, Doe B, Dolan ME, Edie SM, Fuchs H, Gailus-Durner V, Galli A, Gambadoro A, Gallegos J, Guo S, Horner NR, Hsu CW, Johnson SJ, Kalaga S, Keith LC, Lanoue L, Lawson TN, Lek M, Mark M, Marschall S, Mason J, McElwee ML, Newbigging S, Nutter LM, Peterson KA, Ramirez-Solis R, Rowland DJ, Ryder E, Samocha KE, Seavitt JR, Selloum M, Szoke-Kovacs Z, Tamura M, Trainor AG, Tudose I, Wakana S, Warren J, Wendling O, West DB, Wong L, Yoshiki A, MacArthur DG, Tocchini-Valentini GP, Gao X, Flicek P, Bradley A, Skarnes WC, Justice MJ, Parkinson HE, Moore M, Wells S, Braun RE, Svenson KL, de Angelis MH, Herault Y, Mohun T, Mallon AM, Henkelman RM, Brown SD, Adams DJ, Lloyd KC, McKerlie C, Beaudet AL, Bucan M, Murray SA", 
            "date": "2016"
        }, 
        {
            "reference": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/31202927", 
                    "type": [
                        "PubMed"
                    ], 
                    "id": "31202927"
                }
            ], 
            "title": "Osteoblast-specific expression of Panx3 is dispensable for postnatal bone remodeling.", 
            "journal": "Bone", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_898986.2", 
                    "id": "NP_898986.2", 
                    "database": "RefSeq"
                }
            ], 
            "authors": "Yorgan TA, Peters S, Amling M, Schinke T", 
            "date": "2019"
        }
    ], 
    "uniprot_ac": "A2AGA4", 
    "site_annotation": [
        {
            "end_pos": 242, 
            "annotation": "n_glycosylation_sequon", 
            "start_pos": 240
        }
    ], 
    "isoforms": [
        {
            "url": "https://www.uniprot.org/uniprot/A2AGA4#A2AGA4-1", 
            "isoform_ac": "A2AGA4-1", 
            "locus": {
                "end_pos": 123809934, 
                "strand": "-", 
                "start_pos": 123829710, 
                "chromosome": "4", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUST00000053202", 
                        "id": "ENSMUST00000053202", 
                        "database": "Ensembl Transcript"
                    }, 
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSP00000054546", 
                        "id": "ENSMUSP00000054546", 
                        "database": "Ensembl Peptide"
                    }
                ]
            }, 
            "sequence": {
                "header": "sp|A2AGA4-1|RHBL2_MOUSE Isoform 1 of Rhomboid-related protein 2  OS=Mus musculus OX=10090 GN=Rhbdl2 PE=1 SV=1 CANONICAL=A2AGA4-1", 
                "length": 302, 
                "sequence": "MAVAHEMEMESVNLNMEREGKEEPEEEKMKGNGEGKDFPRSRKVHRIVSKWMLPEPVRRTYLERANCLPPPLFIILISLAELAVFIYYAVWKPQKQWITLDTGILESPLTYCPEKREEAWRFISYMLVHAGVQHIVGNLLMQIVLGIPLEMVHKGLRVGLVYLAGVLAGSLASSIFDPLKSLVGASGGVYALMGGYFMNVIVNFREMIPAFGIVRLLVIILIVASDMGFALYRRFFVPANGSPVSFAAHIAGGFAGMSIGYTVFSCFDKTLLKDPRFWIAIAAYVACLLFAVFFNIFLSPAN"
            }
        }
    ], 
    "pathway": [
        {
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:230726", 
            "resource": "KEGG Pathway", 
            "id": "mmu:230726", 
            "name": ""
        }
    ], 
    "function": [
        {
            "url": "https://www.uniprot.org/uniprot/A2AGA4#function", 
            "annotation": "Involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. Known substrate: EFNB3 (By similarity).", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2AGA4#function", 
                    "id": "A2AGA4", 
                    "database": "UniProtKB"
                }
            ]
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_898986.2", 
            "annotation": "RHBDL2 and soluble thrombomodulin were upregulated in ex vivo tissue culture of injured mouse skin. 3,4-Dichloroisocoumarin inhibited thrombomodulin production and wound healing; this was reversed by recombinant thrombomodulin in mice.", 
            "evidence": [
                {
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_898986.2", 
                    "id": "NP_898986.2", 
                    "database": "RefSeq"
                }
            ]
        }
    ], 
    "orthologs": [
        {
            "uniprot_canonical_ac": "D3ZA62-1", 
            "protein_name": "Rhomboid, veinlet-like 2 (Drosophila) (Predicted)", 
            "sequence": {
                "length": 177, 
                "sequence": "MLVHAGVQHIVGNLFMQLVLGIPLEMVHKGLRVGLVYLAGVLAGSLASSIFDPLKSLVGASGGVYALMGGYFMNVIVNFREMIPALGIVRLLVIILIVASDMGFALYRRFFVPANGSPVSFAAHIAGGFAGMSVGYTVFSCFDKTLLKDPRFWISIAAYVACLLFAVFFNIFLSPAN"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/49508", 
                    "id": "49508", 
                    "database": "MGI"
                }
            ], 
            "common_name": "Rat", 
            "organism": "Rattus norvegicus", 
            "gene_name": "Rhbdl2", 
            "tax_id": 10116
        }, 
        {
            "uniprot_canonical_ac": "Q9NX52-1", 
            "protein_name": "Rhomboid-related protein 2, C-terminal fragment", 
            "sequence": {
                "length": 303, 
                "sequence": "MAAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWITLDTGILESPFIYSPEKREEAWRFISYMLVHAGVQHILGNLCMQLVLGIPLEMVHKGLRVGLVYLAGVIAGSLASSIFDPLRYLVGASGGVYALMGGYFMNVLVNFQEMIPAFGIFRLLIIILIIVLDMGFALYRRFFVPEDGSPVSFAAHIAGGFAGMSIGYTVFSCFDKALLKDPRFWIAIAAYLACVLFAVFFNIFLSPAN"
            }, 
            "evidence": [
                {
                    "url": "http://www.informatics.jax.org/homology/49508", 
                    "id": "49508", 
                    "database": "MGI"
                }
            ], 
            "common_name": "Human", 
            "organism": "Homo sapiens", 
            "gene_name": "RHBDL2", 
            "tax_id": 9606
        }
    ], 
    "interactions": [], 
    "synthesized_glycans": [], 
    "snv": [], 
    "cluster_types": [
        {
            "name": "homologset.mgi", 
            "label": "MGI Homologs"
        }
    ], 
    "refseq": {
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_898986.2", 
        "ac": "NP_898986.2", 
        "name": "rhomboid-related protein 2 isoform 1", 
        "summary": ""
    }, 
    "go_annotation": {
        "categories": [
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004252", 
                        "pmid": "21439629", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AGA4", 
                                "id": "A2AGA4", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "serine-type endopeptidase activity", 
                        "id": "GO:0004252"
                    }
                ], 
                "total": 1, 
                "name": "Molecular Function"
            }, 
            {
                "go_terms": [
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AGA4", 
                                "id": "A2AGA4", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "plasma membrane", 
                        "id": "GO:0005886"
                    }, 
                    {
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", 
                        "pmid": "", 
                        "evidence": [
                            {
                                "url": "https://www.uniprot.org/uniprot/A2AGA4", 
                                "id": "A2AGA4", 
                                "database": "UniProtKB"
                            }
                        ], 
                        "name": "integral component of membrane", 
                        "id": "GO:0016021"
                    }
                ], 
                "total": 2, 
                "name": "Cellular Component"
            }
        ]
    }, 
    "gene_names": [
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2AGA4", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "9130416B15; RRP2"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2AGA4", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "Rhbdl2"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AGA4", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "Rhbdl2"
        }
    ], 
    "pro_annotation": [], 
    "crossref": [
        {
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000043333", 
            "id": "ENSMUSG00000043333", 
            "database": "Bgee"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/gene/230726", 
            "id": "230726", 
            "database": "GeneID"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017213", 
            "id": "IPR017213", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR022764", 
            "id": "IPR022764", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR035952", 
            "id": "IPR035952", 
            "database": "InterPro"
        }, 
        {
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:230726", 
            "id": "mmu:230726", 
            "database": "KEGG Pathway"
        }, 
        {
            "url": "http://www.informatics.jax.org/marker/MGI:3608413", 
            "id": "3608413", 
            "database": "MGI"
        }, 
        {
            "url": "https://omabrowser.org/oma/group/FIYRPEK/", 
            "id": "FIYRPEK", 
            "database": "OMA"
        }, 
        {
            "url": "http://www.orthodb.org/?query=1253228at2759", 
            "id": "1253228at2759", 
            "database": "OrthoDB"
        }, 
        {
            "url": "http://pfam.xfam.org/family/PF01694", 
            "id": "PF01694", 
            "database": "Pfam"
        }, 
        {
            "url": "http://purl.obolibrary.org/obo/PR_PR_A2AGA4", 
            "id": "PR_A2AGA4", 
            "database": "PRO"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_898986.2", 
            "id": "NP_898986.2", 
            "database": "RefSeq"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AGA4", 
            "id": "A2AGA4", 
            "database": "UniProtKB"
        }
    ], 
    "expression_disease": [], 
    "glycosylation": [], 
    "mutagenesis": [
        {
            "sequence_org": "A", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2AGA4", 
                    "id": "A2AGA4", 
                    "database": "UniProtKB"
                }, 
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/21439629", 
                    "id": "21439629", 
                    "database": "PubMed"
                }
            ], 
            "sequence_mut": "P", 
            "start_pos": 185, 
            "end_pos": 185, 
            "annotation": "Reduces protease activity."
        }, 
        {
            "sequence_org": "S", 
            "evidence": [
                {
                    "url": "https://www.uniprot.org/uniprot/A2AGA4", 
                    "id": "A2AGA4", 
                    "database": "UniProtKB"
                }, 
                {
                    "url": "https://www.ncbi.nlm.nih.gov/pubmed/21439629", 
                    "id": "21439629", 
                    "database": "PubMed"
                }
            ], 
            "sequence_mut": "A", 
            "start_pos": 186, 
            "end_pos": 186, 
            "annotation": "Abolishes protease activity."
        }
    ], 
    "disease": [], 
    "phosphorylation": [], 
    "mass": {
        "monoisotopic_mass": 33735.0, 
        "chemical_mass": 33735.0
    }, 
    "expression_tissue": [], 
    "gene": [
        {
            "url": "https://www.uniprot.org/uniprot/A2AGA4", 
            "name": "Rhbdl2", 
            "locus": {
                "end_pos": 123829904, 
                "strand": "+", 
                "start_pos": 123787874, 
                "chromosome": "4", 
                "evidence": [
                    {
                        "url": "https://www.ensembl.org/id/ENSMUSG00000043333", 
                        "id": "ENSMUSG00000043333", 
                        "database": "Ensembl Gene"
                    }
                ]
            }
        }
    ], 
    "protein_names": [
        {
            "url": "https://www.uniprot.org/uniprot/A2AGA4#names_and_taxonomy", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "3.4.21.105"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AGA4#names_and_taxonomy", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "CTF"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AGA4#names_and_taxonomy", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "NTF"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AGA4#names_and_taxonomy", 
            "type": "synonym", 
            "resource": "UniProtKB", 
            "name": "RRP2"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AGA4#names_and_taxonomy", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "Rhomboid-related protein 2, C-terminal fragment"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AGA4#names_and_taxonomy", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "Rhomboid-related protein 2, N-terminal fragment"
        }, 
        {
            "url": "https://www.uniprot.org/uniprot/A2AGA4#names_and_taxonomy", 
            "type": "recommended", 
            "resource": "UniProtKB", 
            "name": "Rhomboid-related protein 2"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2AGA4", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "rhomboid-related protein 2 isoform 1"
        }, 
        {
            "url": "https://www.ncbi.nlm.nih.gov/protein/A2AGA4", 
            "type": "synonym", 
            "resource": "RefSeq", 
            "name": "rhomboid-related protein 2; rhomboid, veinlet-like 2"
        }
    ]
}