{ "uniprot_canonical_ac": "A2A288-1", "ptm_annotation": [], "sequence": { "header": "sp|A2A288-1|ZC12D_HUMAN Isoform 1 of Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=3 CANONICAL=A2A288-1", "length": 527, "sequence": "MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDWFRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRHGPSLSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERPHHAQLAVADELRAKTGARPGAGAEEQRPPRAPGGSAGARAAPREPFAHSLPPARGSPDLAALRGSFSRLAFSDDLGPLGPPLPVPACSLTPRLGGPDWVSAGGRVPGPLSLPSPESQFSPGDLPPPPGLQLQPRGEHRPRDLHGDLLSPRRPPDDPWARPPRSDRFPGRSVWAEPAWGDGATGGLSVYATEDDEGDARARARIALYSVFPRDQVDRVMAAFPELSDLARLILLVQRCQSAGAPLGKP" }, "uniprot_id": "ZC12D_HUMAN", "enzyme_annotation": [ { "ec": "3.1.-.-", "activity": "" } ], "glycation": [], "keywords": [], "species": [ { "common_name": "Human", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/17210687", "type": [ "PubMed" ], "id": "17210687" } ], "title": "Identification of a novel tumor suppressor gene p34 on human chromosome 6q25.1.", "journal": "Cancer Res.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "authors": "Amos C.I., Liu Y., Wang Y., Wang D., Bierut L.J., Wang M., Yang P., Gazdar A., Minna J., Petersen G.M., de Andrade M., You M., Wiest J.S., Fain P.R., Vikis H.G., Anderson M.W., Jia D., Bailey-Wilson J.E., Mandal D., Seminara D., Gaba C., Govindan R., Kupert E., Pinney S.M., Rothschild H., Schwartz A.G., Viswanathan A.", "date": "2007" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/17854321", "type": [ "PubMed" ], "id": "17854321" } ], "title": "Deregulation of a possible tumour suppressor gene, ZC3H12D, by translocation of IGK@ in transformed follicular lymphoma with t(2;6)(p12;q25).", "journal": "Br. J. Haematol.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ], "authors": "Ito M., Nishikawa S., Yamamoto K., Katayama Y., Matsui T., Shimoyama M., Okamura A., Yakushijin K., Minagawa K., Sada A.", "date": "2007" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/18178554", "type": [ "PubMed" ], "id": "18178554" } ], "title": "A novel CCCH-zinc finger protein family regulates proinflammatory activation of macrophages.", "journal": "J. Biol. Chem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ], "authors": "Song W., Wang J., Liang J., Kolattukudy P.E., Tromp G., Fu M., Azfer A.", "date": "2008" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/19531561", "type": [ "PubMed" ], "id": "19531561" } ], "title": "Inhibition of G(1) to S phase progression by a novel zinc finger protein P58(TFL) at P-bodies.", "journal": "Mol. Cancer Res.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "authors": "Nishikawa S., Yamamoto K., Katayama Y., Matsui T., Shimoyama M., Okamura A., Minagawa K., Sada A.", "date": "2009" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/21732829", "type": [ "PubMed" ], "id": "21732829" } ], "title": "Wnt signaling and Dupuytren's disease.", "journal": "The New England journal of medicine", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ], "authors": "Dolmans GH, Werker PM, Hennies HC, Furniss D, Festen EA, Franke L, Becker K, van der Vlies P, Wolffenbuttel BH, Tinschert S, Toliat MR, Nothnagel M, Franke A, Klopp N, Wichmann HE, Nurnberg P, Giele H, Ophoff RA, Wijmenga C", "date": "2011" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/22036805", "type": [ "PubMed" ], "id": "22036805" } ], "title": "The putative tumor suppressor Zc3h12d modulates toll-like receptor signaling in macrophages.", "journal": "Cellular signalling", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ], "authors": "Huang S, Qi D, Liang J, Miao R, Minagawa K, Quinn T, Matsui T, Fan D, Liu J, Fu M", "date": "2012" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/24415781", "type": [ "PubMed" ], "id": "24415781" } ], "title": "Posttranscriptional modulation of cytokine production in T cells for the regulation of excessive inflammation by TFL.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ], "authors": "Minagawa K, Wakahashi K, Kawano H, Nishikawa S, Fukui C, Kawano Y, Asada N, Sato M, Sada A, Katayama Y, Matsui T", "date": "2014" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/26059755", "type": [ "PubMed" ], "id": "26059755" } ], "title": "ZC3H12D attenuated inflammation responses by reducing mRNA stability of proinflammatory genes.", "journal": "Molecular immunology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ], "authors": "Zhang H, Wang WC, Chen JK, Zhou L, Wang M, Wang ZD, Yang B, Xia YM, Lei S, Fu EQ, Jiang T", "date": "2015" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/26134560", "type": [ "PubMed" ], "id": "26134560" } ], "title": "Monocyte chemotactic protein-induced protein 1 and 4 form a complex but act independently in regulation of interleukin-6 mRNA degradation.", "journal": "J. Biol. Chem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ], "authors": "Kumar A., Liu G., Liu S., Yao X., Huang S., Fu M., Fu J.J., Tony Wang T.", "date": "2015" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27472830", "type": [ "PubMed" ], "id": "27472830" } ], "title": "Intact NYN/PIN-Like Domain is Crucial for the Degradation of Inflammation-Related Transcripts by ZC3H12D.", "journal": "Journal of cellular biochemistry", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ], "authors": "Wawro M, Kochan J, Krzanik S, Jura J, Kasza A", "date": "2017" } ], "uniprot_ac": "A2A288", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A2A288#A2A288-1", "isoform_ac": "A2A288-1", "locus": { "end_pos": 149450686, "strand": "+", "start_pos": 149474543, "chromosome": "6", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000409806", "id": "ENST00000409806", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000386616", "id": "ENSP00000386616", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A2A288-1|ZC12D_HUMAN Isoform 1 of Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=3 CANONICAL=A2A288-1", "length": 527, "sequence": "MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDWFRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRHGPSLSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERPHHAQLAVADELRAKTGARPGAGAEEQRPPRAPGGSAGARAAPREPFAHSLPPARGSPDLAALRGSFSRLAFSDDLGPLGPPLPVPACSLTPRLGGPDWVSAGGRVPGPLSLPSPESQFSPGDLPPPPGLQLQPRGEHRPRDLHGDLLSPRRPPDDPWARPPRSDRFPGRSVWAEPAWGDGATGGLSVYATEDDEGDARARARIALYSVFPRDQVDRVMAAFPELSDLARLILLVQRCQSAGAPLGKP" } }, { "url": "https://www.uniprot.org/uniprot/A2A288#A2A288-3", "isoform_ac": "A2A288-3", "locus": {}, "sequence": { "header": "sp|A2A288-3|ZC12D_HUMAN Isoform 3 of Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=3 CANONICAL=A2A288-1", "length": 227, "sequence": "MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDWFRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDR" } }, { "url": "https://www.uniprot.org/uniprot/A2A288#A2A288-4", "isoform_ac": "A2A288-4", "locus": {}, "sequence": { "header": "sp|A2A288-4|ZC12D_HUMAN Isoform 4 of Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=3 CANONICAL=A2A288-1", "length": 321, "sequence": "MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDWFRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRHGPSLSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERPHHAQLAVADELRAKTGARPVLPGRPPASARPAAPAAGRTPP" } }, { "url": "https://www.uniprot.org/uniprot/A2A288#B7ZBA4-1", "isoform_ac": "B7ZBA4-1", "locus": { "end_pos": 149459623, "strand": "+", "start_pos": 149474543, "chromosome": "6", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000409948", "id": "ENST00000409948", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000387062", "id": "ENSP00000387062", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|B7ZBA4-1|ZC12D_HUMAN Computationally mapped isoform of Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=1 CANONICAL=A2A288-1", "length": 167, "sequence": "MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDWFRDRGHTYIKVFVPSWRKDPPRADTPIRGIGMGNEWRSILLGAAARE" } }, { "url": "https://www.uniprot.org/uniprot/A2A288#H0Y4Y6-1", "isoform_ac": "H0Y4Y6-1", "locus": { "end_pos": 149452609, "strand": "+", "start_pos": 149456869, "chromosome": "6", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000458251", "id": "ENST00000458251", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000395209", "id": "ENSP00000395209", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|H0Y4Y6-1|ZC12D_HUMAN Computationally mapped isoform of Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=1 CANONICAL=A2A288-1", "length": 106, "sequence": "XAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRHGPSLSNFLSRKPKPPEPSWQHCPYGG" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:340152", "resource": "KEGG Pathway", "id": "hsa:340152", "name": "" } ], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "annotation": "MCPIP1 and MCPIP4 form a complex but they act independently in regulation of IL-6 mRNA degradation.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "annotation": "MCPIP1, 2, 3, and 4, encoded by four genes, Zc3h12a, Zc3h12b, Zc3h12c, and Zc3h12d, respectively, regulates macrophage activation.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ] }, { "url": "https://www.uniprot.org/uniprot/A2A288#function", "annotation": "May regulate cell growth likely by suppressing RB1 phosphorylation (PubMed:19531561). May function as RNase and regulate the levels of target RNA species (Potential). In association with ZC3H12A enhances the degradation of interleukin IL-6 mRNA level in activated macrophages (PubMed:26134560). Serve as a tumor suppressor in certain leukemia cells (PubMed:17210687). Overexpression inhibits the G1 to S phase progression through suppression of RB1 phosphorylation (PubMed:19531561).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288#function", "id": "A2A288", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "annotation": "Overexpression of ZC3H12D increases the turnover rate of transcripts containing ZC3H12A 3'UTR.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "annotation": "The data indicated that ZC3H12D could suppress both the initial inflammation storm and chronic inflammation by targeting the mRNA of cytokines as well as NF-kappaB and c-fos.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "annotation": "Zc3h12d is a novel negative feedback regulator of TLR signaling and macrophage activation and thus may play a role in host immunity and inflammatory diseases.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "D4A0I4-1", "protein_name": "Zinc finger CCCH type-containing 12D", "sequence": { "length": 533, "sequence": "MERRGKMEFFQKLGYSQEDVVRVLGKLGDGALVNDVLQELIQTGSRPKAQEDPANGTGIVLMPRGCCGVRDSAQQGLGLGLEEAGGDPASFLRPIVIDGSNVAMSHGNKEAFSCRGIRLAVDWFRDRGHTYIKVFVPSWRKEPSRSDTPIREQHVLEELERQAVLVYTPSRKVNGKRVVCYDDRYIVKLAYEKDGVIVSNDNYRDLQNENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRRGPTLSNFLSKKPRPPEPSWQHCPYGKKCTYGVKCRFYHPERPHQGQLPVADELRAKTRAWPGGGAGESRPPSARSRPGAARPLPLEPGAHNPTPAPQPAALTALNQSFARLTFSDTAASGVVSLSRGPDRMPTSGPTSWASPSLRAGSVATQGSPGLRCLRTPNSLLSPGDLGSPICPQSQPSDRHCSRGMHSDLPPQRRPPEDPWAFLPSSYGYLNHSVWAESAWSENTFGRPSGSAQSTINSGGTRASLCSAFPSDREDPVMASDPVLSDVALRTLLQRSQKTGAPLGDP" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/18225", "id": "18225", "database": "MGI" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "gene_name": "Zc3h12d", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q8BIY3-1", "protein_name": "Probable ribonuclease ZC3H12D", "sequence": { "length": 533, "sequence": "MEHRSKMEFFQKLGYSQEDVVRVLGKLGDSALVNDVLQELIQTGSRPRAQEDPASGTGVVLIPRGCCGVQDSAQQGPGTRPRRGWRRSSPLLRPIVIDGSNVAMSHGNKEAFSCRGIRLAVDWFTDRGHTYIKVFVPSWRKEPSRSDTPIREQHVLEELERQAVLVYTPSRKVNGKRVVCYDDRYIVKVAYEKDGIIVSNDNYRDLQNENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRRGPTLSNFLSKKPRPPEPSWQHCPYGKKCTYGVKCRFYHPERPHHGQLSVADELRAKTRAWLGGGAEEPRTPSARSRPTTARLLPQEPGEHDLPPAPQPAVLAALNRSFARLTFSDTAASGVVSQSRGPDWMPTGVPTSWAPPSLRAGSAATIGLPGMRSLRTPNNPLSPGDLGSPICPQARLSERHRSRDMHSDLPPQRRPLEDPWALLPSSYCYLNHSVWSESAWGEDIFRGPSESAQPVANGGGTRPVHCSFFPPDQDHPVMASGPPLSDMALLTLLQRSQKTGAPLGDP" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/18225", "id": "18225", "database": "MGI" } ], "common_name": "Mouse", "organism": "Mus musculus", "gene_name": "Zc3h12d", "tax_id": 10090 } ], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "P", "start_pos": 405, "alt_nt": "A", "chr_id": "6", "ref_nt": "G", "chr_pos": "149772190", "disease": [ { "synonyms": [], "recommended_name": { "id": "DOID:9256", "url": "http://disease-ontology.org/term/DOID:9256", "resource": "Disease Ontology", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." } }, { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } }, { "synonyms": [ { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "primary breast cancer", "description": "" } ], "recommended_name": { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "1.4", "sequence_mut": "S", "subjects_tested": "348", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 2 out of 6 filters: patient freq. (1.4%); num. of cancers (3).", "end_pos": 405, "minor_allelic_frequency": "", "subjects_positive": "5" }, { "sequence_org": "M", "start_pos": 1, "alt_nt": "C", "chr_id": "6", "ref_nt": "T", "chr_pos": "149795679", "disease": [ { "synonyms": [ { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "malignant hematopoietic neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:2531", "url": "http://disease-ontology.org/term/DOID:2531", "resource": "Disease Ontology", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "2.1", "sequence_mut": "V", "subjects_tested": "48", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.1%).", "end_pos": 1, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "G", "start_pos": 269, "alt_nt": "G", "chr_id": "6", "ref_nt": "C", "chr_pos": "149772597", "disease": [ { "synonyms": [], "recommended_name": { "id": "DOID:9256", "url": "http://disease-ontology.org/term/DOID:9256", "resource": "Disease Ontology", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "1.1", "sequence_mut": "A", "subjects_tested": "94", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%).", "end_pos": 269, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "E", "start_pos": 290, "alt_nt": "A", "chr_id": "6", "ref_nt": "T", "chr_pos": "149772534", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "2.0", "sequence_mut": "V", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%).", "end_pos": 290, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "R", "start_pos": 42, "alt_nt": "A", "chr_id": "6", "ref_nt": "G", "chr_pos": "149795556", "disease": [ { "synonyms": [ { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "primary breast cancer", "description": "" } ], "recommended_name": { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "2.0", "sequence_mut": "C", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%).", "end_pos": 42, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "R", "start_pos": 439, "alt_nt": "A", "chr_id": "6", "ref_nt": "G", "chr_pos": "149772088", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "2.0", "sequence_mut": "C", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%).", "end_pos": 439, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "R", "start_pos": 439, "alt_nt": "T", "chr_id": "6", "ref_nt": "C", "chr_pos": "149772087", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "2.0", "sequence_mut": "H", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%).", "end_pos": 439, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "R", "start_pos": 46, "alt_nt": "A", "chr_id": "6", "ref_nt": "G", "chr_pos": "149795544", "disease": [ { "synonyms": [ { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "primary breast cancer", "description": "" } ], "recommended_name": { "id": "DOID:1612", "url": "http://disease-ontology.org/term/DOID:1612", "resource": "Disease Ontology", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "1.4", "sequence_mut": "C", "subjects_tested": "72", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.4%).", "end_pos": 46, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "G", "start_pos": 525, "alt_nt": "T", "chr_id": "6", "ref_nt": "C", "chr_pos": "149771830", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "2.0", "sequence_mut": "S", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%).", "end_pos": 525, "minor_allelic_frequency": "", "subjects_positive": "1" } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "ac": "NP_997243.2", "name": "probable ribonuclease ZC3H12D", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003729", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "mRNA binding", "id": "GO:0003729" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004521", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "endoribonuclease activity", "id": "GO:0004521" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "metal ion binding", "id": "GO:0046872" } ], "total": 3, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "pmid": "19531561", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "pmid": "19531561", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000932", "pmid": "26134560", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "P-body", "id": "GO:0000932" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "nucleoplasm", "id": "GO:0005654" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036464", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "cytoplasmic ribonucleoprotein granule", "id": "GO:0036464" } ], "total": 5, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030308", "pmid": "19531561", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "negative regulation of cell growth", "id": "GO:0030308" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006402", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "mRNA catabolic process", "id": "GO:0006402" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000134", "pmid": "19531561", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "negative regulation of G1/S transition of mitotic cell cycle", "id": "GO:2000134" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090502", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "RNA phosphodiester bond hydrolysis, endonucleolytic", "id": "GO:0090502" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061158", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "name": "3'-UTR-mediated mRNA destabilization", "id": "GO:0061158" } ], "total": 5, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A2A288", "type": "synonym", "resource": "RefSeq", "name": "C6orf95; dJ281H8.1; MCPIP4; p34; TFL" }, { "url": "https://www.uniprot.org/uniprot/A2A288", "type": "synonym", "resource": "UniProtKB", "name": "C6orf95" }, { "url": "https://www.uniprot.org/uniprot/A2A288", "type": "synonym", "resource": "UniProtKB", "name": "MCPIP4" }, { "url": "https://www.uniprot.org/uniprot/A2A288", "type": "synonym", "resource": "UniProtKB", "name": "TFL" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2A288", "type": "synonym", "resource": "RefSeq", "name": "ZC3H12D" }, { "url": "https://www.uniprot.org/uniprot/A2A288", "type": "recommended", "resource": "UniProtKB", "name": "ZC3H12D" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A2A288", "id": "A2A288", "database": "BioMuta" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ZC3H12D", "id": "ZC3H12D", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/340152", "id": "340152", "database": "GeneID" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=21175", "id": "21175", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000571", "id": "IPR000571", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR021869", "id": "IPR021869", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR040546", "id": "IPR040546", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:340152", "id": "hsa:340152", "database": "KEGG Pathway" }, { "url": "http://www.omim.org/entry/611106", "id": "611106", "database": "MIM" }, { "url": "https://www.nextprot.org/entry/NX_A2A288", "id": "NX_A2A288", "database": "neXtProt" }, { "url": "https://omabrowser.org/oma/group/RPPDDPW/", "id": "RPPDDPW", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=771251at2759", "id": "771251at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF11977", "id": "PF11977", "database": "Pfam" }, { "url": "http://pfam.xfam.org/family/PF18039", "id": "PF18039", "database": "Pfam" }, { "url": "https://pharos.nih.gov/targets/A2A288", "id": "A2A288", "database": "PHAROS" }, { "url": "http://purl.obolibrary.org/obo/PR_PR_A2A288", "id": "PR_A2A288", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_997243.2", "id": "NP_997243.2", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" } ], "expression_disease": [ { "name": "Prostate cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "tumor of the prostate", "description": "" } ], "recommended_name": { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2A288", "id": "A2A288", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:10283", "significant": "Yes" }, { "name": "Urinary bladder cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2A288", "id": "A2A288", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:11054", "significant": "No" }, { "name": "Thyroid gland cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2A288", "id": "A2A288", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:1781", "significant": "No" }, { "name": "Liver cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "recommended_name": { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2A288", "id": "A2A288", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3571", "significant": "No" }, { "name": "Lung squamous cell carcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "Epidermoid cell carcinoma of the lung", "description": "" } ], "recommended_name": { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "lung squamous cell carcinoma", "description": "A non-small cell lung carcinoma that has_material_basis_in the squamous cell." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2A288", "id": "A2A288", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3907", "significant": "Yes" }, { "name": "Lung adenocarcinoma [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "bronchogenic lung adenocarcinoma", "description": "" }, { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "nonsmall cell adenocarcinoma", "description": "" } ], "recommended_name": { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "lung adenocarcinoma", "description": "A lung cancer that derives_from epithelial cells of glandular origin." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2A288", "id": "A2A288", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3910", "significant": "No" }, { "name": "Esophageal cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of the middle Third of the esophagus", "description": "" } ], "recommended_name": { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A2A288", "id": "A2A288", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:5041", "significant": "Yes" } ], "glycosylation": [], "mutagenesis": [ { "sequence_org": "D", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "id": "A2A288", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/26134560", "id": "26134560", "database": "PubMed" } ], "sequence_mut": "N", "start_pos": 95, "end_pos": 95, "annotation": "Inhibits interleukin IL6 mRNA instability." } ], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 58078.0, "chemical_mass": 58078.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000178199", "id": "ENSG00000178199", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A2A288", "name": "ZC3H12D", "locus": { "end_pos": 149446795, "strand": "-", "start_pos": 149485061, "chromosome": "6", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000178199", "id": "ENSG00000178199", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A2A288#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "3.1.-.-" }, { "url": "https://www.uniprot.org/uniprot/A2A288#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "MCP-induced protein 4" }, { "url": "https://www.uniprot.org/uniprot/A2A288#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "Probable ribonuclease ZC3H12D" }, { "url": "https://www.uniprot.org/uniprot/A2A288#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Transformed follicular lymphoma" }, { "url": "https://www.uniprot.org/uniprot/A2A288#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Zinc finger CCCH domain-containing protein 12D" }, { "url": "https://www.uniprot.org/uniprot/A2A288#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "p34" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2A288", "type": "synonym", "resource": "RefSeq", "name": "probable ribonuclease ZC3H12D" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A2A288", "type": "synonym", "resource": "RefSeq", "name": "tumor suppressor TFL; Zinc finger CCCH domain-containing protein 12D; transformed follicular lymphoma" } ] }