{ "uniprot_canonical_ac": "A1L1L1-1", "ptm_annotation": [], "sequence": { "header": "sp|A1L1L1-1|CENPW_RAT Isoform 1 of Centromere protein W OS=Rattus norvegicus OX=10116 GN=Cenpw PE=3 SV=1 CANONICAL=A1L1L1-1", "length": 86, "sequence": "MVLSTTVCRRIRRKAPCAFLKRTLKQKKPRLSLEKRCDLLIHLNCLLFVQKLAEESRTNACESKSGVIKKDHVQAAAKVILKKSRG" }, "uniprot_id": "CENPW_RAT", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Rat", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "Rattus norvegicus", "taxid": 10116 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/19533040", "type": [ "PubMed" ], "id": "19533040" } ], "title": "Cancer-upregulated gene 2 (CUG2), a new component of centromere complex, is required for kinetochore function.", "journal": "Molecules and cells", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001233248.1", "id": "NP_001233248.1", "database": "RefSeq" } ], "authors": "Kim H, Lee M, Lee S, Park B, Koh W, Lee DJ, Lim DS, Lee S", "date": "2009" } ], "uniprot_ac": "A1L1L1", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1#A1L1L1-1", "isoform_ac": "A1L1L1-1", "locus": { "end_pos": 29915557, "strand": "-", "start_pos": 29919369, "chromosome": "1", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000065677", "id": "ENSRNOT00000065677", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000061737", "id": "ENSRNOP00000061737", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A1L1L1-1|CENPW_RAT Isoform 1 of Centromere protein W OS=Rattus norvegicus OX=10116 GN=Cenpw PE=3 SV=1 CANONICAL=A1L1L1-1", "length": 86, "sequence": "MVLSTTVCRRIRRKAPCAFLKRTLKQKKPRLSLEKRCDLLIHLNCLLFVQKLAEESRTNACESKSGVIKKDHVQAAAKVILKKSRG" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:689399", "resource": "KEGG Pathway", "id": "rno:689399", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-606279", "resource": "Reactome", "id": "R-RNO-606279", "name": "Deposition of new CENPA-containing nucleosomes at the centromere" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1#function", "annotation": "Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation (By similarity). The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres (By similarity). Part of a nucleosome-associated complex that binds specifically to histone H3-containing nucleosomes at the centromere, as opposed to nucleosomes containing CENPA. Component of the heterotetrameric CENP-T-W-S-X complex that binds and supercoils DNA, and plays an important role in kinetochore assembly. CENPW has a fundamental role in kinetochore assembly and function. It is one of the inner kinetochore proteins, with most further proteins binding downstream. Required for normal chromosome organization and normal progress through mitosis (By similarity).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1#function", "id": "A1L1L1", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q3URR0-1", "protein_name": "Centromere protein W", "sequence": { "length": 86, "sequence": "MAPSTTVTRRVKRKAPRAFLKRTLKQKKPHLGLGRCCDLLIHLNCLLFIQRLAEESRTNACESKSRVIKKDHVLAAGKVILKKSRG" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/84642", "id": "84642", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A1L1L1/", "id": "A1L1L1", "database": "OMA" } ], "common_name": "Mouse", "organism": "Mus musculus", "gene_name": "Cenpw", "tax_id": 10090 }, { "uniprot_canonical_ac": "Q5EE01-1", "protein_name": "Centromere protein W", "sequence": { "length": 88, "sequence": "MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/84642", "id": "84642", "database": "MGI" } ], "common_name": "Human", "organism": "Homo sapiens", "gene_name": "CENPW", "tax_id": 9606 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001233248.1", "ac": "NP_001233248.1", "name": "centromere protein W", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "DNA binding", "id": "GO:0003677" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "protein heterodimerization activity", "id": "GO:0046982" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "nucleoplasm", "id": "GO:0005654" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "nucleolus", "id": "GO:0005730" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000775", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "chromosome, centromeric region", "id": "GO:0000775" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016363", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "nuclear matrix", "id": "GO:0016363" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000776", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "kinetochore", "id": "GO:0000776" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000777", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "condensed chromosome kinetochore", "id": "GO:0000777" } ], "total": 6, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051225", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "spindle assembly", "id": "GO:0051225" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051382", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "kinetochore assembly", "id": "GO:0051382" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000278", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "mitotic cell cycle", "id": "GO:0000278" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007059", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "chromosome segregation", "id": "GO:0007059" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "cell division", "id": "GO:0051301" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051276", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "name": "chromosome organization", "id": "GO:0051276" } ], "total": 6, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L1L1", "type": "synonym", "resource": "RefSeq", "name": "CENP-W" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L1L1", "type": "synonym", "resource": "RefSeq", "name": "Cenpw" }, { "url": "https://www.uniprot.org/uniprot/A1L1L1", "type": "recommended", "resource": "UniProtKB", "name": "Cenpw" }, { "url": "https://www.uniprot.org/uniprot/A1L1L1", "type": "synonym", "resource": "UniProtKB", "name": "Cug2" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000042944", "id": "ENSRNOG00000042944", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/689399", "id": "689399", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072", "id": "IPR009072", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR028847", "id": "IPR028847", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:689399", "id": "rno:689399", "database": "KEGG Pathway" }, { "url": "https://omabrowser.org/oma/group/IIKKDHV/", "id": "IIKKDHV", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1578618at2759", "id": "1578618at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF15510", "id": "PF15510", "database": "Pfam" }, { "url": "http://purl.obolibrary.org/obo/PR_PR_A1L1L1", "id": "PR_A1L1L1", "database": "PRO" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-606279", "id": "R-RNO-606279", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001233248.1", "id": "NP_001233248.1", "database": "RefSeq" }, { "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1593465", "id": "1593465", "database": "RGD" }, { "url": "https://www.uniprot.org/uniprot/A1L1L1", "id": "A1L1L1", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 9803.0, "chemical_mass": 9803.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1", "name": "Cenpw", "locus": { "end_pos": 29920598, "strand": "+", "start_pos": 29915443, "chromosome": "1", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOG00000042944", "id": "ENSRNOG00000042944", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A1L1L1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "CENP-W" }, { "url": "https://www.uniprot.org/uniprot/A1L1L1#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Cancer-up-regulated gene 2 protein" }, { "url": "https://www.uniprot.org/uniprot/A1L1L1#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "Centromere protein W" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L1L1", "type": "synonym", "resource": "RefSeq", "name": "cancer-up-regulated gene 2 protein" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L1L1", "type": "synonym", "resource": "RefSeq", "name": "centromere protein W" } ] }