{ "uniprot_canonical_ac": "A1L1B4-1", "ptm_annotation": [], "sequence": { "header": "tr|A1L1B4-1|A1L1B4_MOUSE Isoform 1 of Olfactory receptor OS=Mus musculus OX=10090 GN=Olfr282 PE=2 SV=1 CANONICAL=A1L1B4-1", "length": 308, "sequence": "MAWSNHSVITEFVLTGLSDDPLIPALLFALFLGIYVLTMTGNLTMLLVITADSHLHTPMYFFLSNLSFVDLCFSSVTIPKLLKDLLSAKKTISIEGCLAQVFFVFFSSGTEACLLSVMAYDRYAAICHPLLYGQVMRNELCVRLVVISWGVASLNATIIVLLAVNLDFCGAQTIHHYTCELPALFPLSCSDISITVVVLLCSSLLHGLGTFIPIFFSYARIVSAILSISSTTGRSKAFSTCSSHLAAVTLFFGSGFLCYLMPPSGSSLDLLLSLQYSAVTPMLNPLIYSLKNQEVKAAVQRTLRKYLL" }, "uniprot_id": "A1L1B4_MOUSE", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Mouse", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1B4", "id": "A1L1B4", "database": "UniProtKB" } ], "name": "Mus musculus", "taxid": 10090 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/10706615", "type": [ "PubMed" ], "id": "10706615" } ], "title": "The olfactory receptor gene repertoire in primates and mouse: evidence for reduction of the functional fraction in primates.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666668.2", "id": "NP_666668.2", "database": "RefSeq" } ], "authors": "Rouquier S, Blancher A, Giorgi D", "date": "2000" } ], "uniprot_ac": "A1L1B4", "site_annotation": [ { "end_pos": 157, "annotation": "n_glycosylation_sequon", "start_pos": 155 }, { "end_pos": 44, "annotation": "n_glycosylation_sequon", "start_pos": 42 }, { "end_pos": 7, "annotation": "n_glycosylation_sequon", "start_pos": 5 }, { "end_pos": 67, "annotation": "n_glycosylation_sequon", "start_pos": 65 } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1L1B4#A0A0U1RP22-1", "isoform_ac": "A0A0U1RP22-1", "locus": { "end_pos": 98437822, "strand": "-", "start_pos": 98437914, "chromosome": "15", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000205491", "id": "ENSMUST00000205491", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000145796", "id": "ENSMUSP00000145796", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A0A0U1RP22-1|A1L1B4_MOUSE Computationally mapped isoform of Olfactory receptor OS=Mus musculus OX=10090 GN=Olfr282 PE=2 SV=1 CANONICAL=A1L1B4-1", "length": 31, "sequence": "MAYDRYAAICHPLLYGQVMRNELCVRLVVIS" } }, { "url": "https://www.uniprot.org/uniprot/A1L1B4#A1L1B4-1", "isoform_ac": "A1L1B4-1", "locus": { "end_pos": 98437471, "strand": "-", "start_pos": 98438394, "chromosome": "15", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUST00000213608", "id": "ENSMUST00000213608", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSMUSP00000149792", "id": "ENSMUSP00000149792", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A1L1B4-1|A1L1B4_MOUSE Isoform 1 of Olfactory receptor OS=Mus musculus OX=10090 GN=Olfr282 PE=2 SV=1 CANONICAL=A1L1B4-1", "length": 308, "sequence": "MAWSNHSVITEFVLTGLSDDPLIPALLFALFLGIYVLTMTGNLTMLLVITADSHLHTPMYFFLSNLSFVDLCFSSVTIPKLLKDLLSAKKTISIEGCLAQVFFVFFSSGTEACLLSVMAYDRYAAICHPLLYGQVMRNELCVRLVVISWGVASLNATIIVLLAVNLDFCGAQTIHHYTCELPALFPLSCSDISITVVVLLCSSLLHGLGTFIPIFFSYARIVSAILSISSTTGRSKAFSTCSSHLAAVTLFFGSGFLCYLMPPSGSSLDLLLSLQYSAVTPMLNPLIYSLKNQEVKAAVQRTLRKYLL" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258449", "resource": "KEGG Pathway", "id": "mmu:258449", "name": "" } ], "function": [], "orthologs": [ { "uniprot_canonical_ac": "Q5USB9-1", "protein_name": "Olfactory receptor", "sequence": { "length": 308, "sequence": "MAWSNHSSITEFVLTGLSDDPLIQALLFTLFLGIYILTMTGNLMMLLVIGADSHLHTPMYYFLSNLSFVDLCFSTVTVPKLLKDLLSVKKSISIEGCLAQVFFVFFSSGTEACLLSVMAYDRYAAICHPLLYGQVMRNELCVRLVLVSWGVASLNATIIVLLAVNLDFCEAQTIHHYTCELPALFPLSCSDISITVDVLLCSSLLHGLGTFIPIFFSYARIVSAILSISSTTGRSKAFSTCSSHLAAVTLFFGSGFLCYLMPPSGSSLDLLLSLQYSAVTPMLNPLIYSLKNKEVKAAVKRTLRKYLL" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/133621", "id": "133621", "database": "MGI" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "gene_name": "Olr1107", "tax_id": 10116 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666668.2", "ac": "NP_666668.2", "name": "olfactory receptor 282", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "pmid": "14611657", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1B4", "id": "A1L1B4", "database": "UniProtKB" } ], "name": "olfactory receptor activity", "id": "GO:0004984" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1B4", "id": "A1L1B4", "database": "UniProtKB" } ], "name": "G protein-coupled receptor activity", "id": "GO:0004930" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016021", "pmid": "14611657", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1B4", "id": "A1L1B4", "database": "UniProtKB" } ], "name": "integral component of membrane", "id": "GO:0016021" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1B4", "id": "A1L1B4", "database": "UniProtKB" } ], "name": "plasma membrane", "id": "GO:0005886" } ], "total": 2, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "pmid": "14611657", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1B4", "id": "A1L1B4", "database": "UniProtKB" } ], "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007608", "pmid": "14611657", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1L1B4", "id": "A1L1B4", "database": "UniProtKB" } ], "name": "sensory perception of smell", "id": "GO:0007608" } ], "total": 2, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L1B4", "type": "synonym", "resource": "RefSeq", "name": "MOR160; MOR160-2" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L1B4", "type": "synonym", "resource": "RefSeq", "name": "Olfr282" }, { "url": "https://www.uniprot.org/uniprot/A1L1B4", "type": "recommended", "resource": "UniProtKB", "name": "Olfr282" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000063780", "id": "ENSMUSG00000063780", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/258449", "id": "258449", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "id": "IPR000276", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "id": "IPR000725", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "id": "IPR017452", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:258449", "id": "mmu:258449", "database": "KEGG Pathway" }, { "url": "http://www.informatics.jax.org/marker/MGI:3030116", "id": "3030116", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/GFLCYLM/", "id": "GFLCYLM", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1040844at2759", "id": "1040844at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF13853", "id": "PF13853", "database": "Pfam" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_666668.2", "id": "NP_666668.2", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A1L1B4", "id": "A1L1B4", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 33631.0, "chemical_mass": 33631.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1L1B4", "name": "Olfr282", "locus": { "end_pos": 98438638, "strand": "+", "start_pos": 98431225, "chromosome": "15", "evidence": [ { "url": "https://www.ensembl.org/id/ENSMUSG00000063780", "id": "ENSMUSG00000063780", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A1L1B4#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "Olfactory receptor" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L1B4", "type": "synonym", "resource": "RefSeq", "name": "olfactory receptor 282" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1L1B4", "type": "synonym", "resource": "RefSeq", "name": "olfactory receptor MOR160-2; GA_x6K02T2NBG7-5293798-5292872" } ] }