{ "uniprot_canonical_ac": "A1E959-1", "ptm_annotation": [ { "annotation": "O-glycosylated.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/", "id": "", "database": "PubMed" } ] } ], "sequence": { "header": "sp|A1E959-1|ODAM_HUMAN Isoform 1 of Odontogenic ameloblast-associated protein OS=Homo sapiens OX=9606 GN=ODAM PE=1 SV=1 CANONICAL=A1E959-1", "length": 279, "sequence": "MKIIILLGFLGATLSAPLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP" }, "uniprot_id": "ODAM_HUMAN", "enzyme_annotation": [], "glycation": [], "keywords": [ "glycoprotein", "predicted.uniprotkb_gly", "reported_with_glycan.oglcnac_db" ], "species": [ { "common_name": "Human", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/14647039", "type": [ "PubMed" ], "id": "14647039" } ], "title": "Calcifying epithelial odontogenic (Pindborg) tumor-associated amyloid consists of a novel human protein.", "journal": "J. Lab. Clin. Med.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ], "authors": "Sletten K., Eulitz M., Solomon A., Westermark P., Donnell R.L., Hrncic R., Murphy C.L., Weaver K., Weiss D.T., Westermark G.", "date": "2003" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/16674676", "type": [ "PubMed" ], "id": "16674676" } ], "title": "Identification of secreted and membrane proteins in the rat incisor enamel organ using a signal-trap screening approach.", "journal": "European journal of oral sciences", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ], "authors": "Moffatt P, Smith CE, Sooknanan R, St-Arnaud R, Nanci A", "date": "2006" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/16959974", "type": [ "PubMed" ], "id": "16959974" } ], "title": "The consensus coding sequences of human breast and colorectal cancers.", "journal": "Science", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "authors": "Bachman K.E., Barber T.D., Buckhaults P., Dawson D., Farrell C., Gazdar A.F., Hartigan J., Jones S., Kinzler K.W., Leary R.J., Lin J., Liu C., Mandelker D., Markowitz S.D., Meeh P., Papadopoulos N., Park B.H., Parmigiani G., Parsons D.W., Ptak J., Silliman N., Sjoeblom T., Szabo S., Velculescu V.E., Vogelstein B., Willis J., Willson J.K.V., Wood L.D., Wu L.", "date": "2006" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/17647262", "type": [ "PubMed" ], "id": "17647262" } ], "title": "Characterization of Apin, a secreted protein highly expressed in tooth-associated epithelia.", "journal": "J. Cell. Biochem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ], "authors": "Smith C.E., St Arnaud R., Moffatt P., Nanci A.", "date": "2008" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/18472969", "type": [ "PubMed" ], "id": "18472969" } ], "title": "Expression of odontogenic ameloblast-associated protein (ODAM) in dental and other epithelial neoplasms.", "journal": "Molecular medicine (Cambridge, Mass.)", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ], "authors": "Kestler DP, Foster JS, Macy SD, Murphy CL, Weiss DT, Solomon A", "date": "2008" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/25911094", "type": [ "PubMed" ], "id": "25911094" } ], "title": "Odontogenic ameloblast-associated protein (ODAM) Mediates Junctional Epithelium Attachment to Tooth via Integrin-ODAM-Rho guanine nucleotide exchange factor 5 (ARHGEF5)-Ras homolog gene family member A (RhoA) Signaling.", "journal": "J. Biol. Chem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "authors": "Park S.Y., Lee H.J., Choi Y., Choung H.W., Ji S., Lee H.K., Park J.C., Park S.J.", "date": "2015" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27229116", "type": [ "PubMed" ], "id": "27229116" } ], "title": "The clinical correlation of phosphatase and tensin homolog on chromosome 10, phosphorylation of AKT to an activated state, and odontogenic ameloblast-associated protein in gastrointestinal stromal tumors.", "journal": "The Journal of surgical research", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ], "authors": "McLoughlin J, Nodit L, Heidel RE, Van Meter S, Macy S, Kestler D", "date": "2016" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/27694004", "type": [ "PubMed" ], "id": "27694004" } ], "title": "Odontogenic ameloblast-associated protein (ODAM) inhibits human colorectal cancer growth by promoting PTEN elevation and inactivating PI3K/AKT signaling.", "journal": "Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ], "authors": "Yu M, Mu Y, Qi Y, Qin S, Qiu Y, Cui R, Zhong M", "date": "2016" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/28411811", "type": [ "PubMed" ], "id": "28411811" } ], "title": "A novel strategy for global mapping of O-GlcNAc proteins and peptides using selective enzymatic deglycosylation, HILIC enrichment and mass spectrometry identification.", "journal": "Talanta", "evidence": [ { "url": "https://data.glygen.org/GLYDS000517", "id": "GLYDS000517", "database": "GlyGen" } ], "authors": "Shen B, Zhang W, Shi Z, Tian F, Deng Y, Sun C, Wang G, Qin W, Qian X", "date": "2017" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/29745811", "type": [ "PubMed" ], "id": "29745811" } ], "title": "The enamel protein ODAM promotes mineralization in a collagen matrix.", "journal": "Connective tissue research", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ], "authors": "Ikeda Y, Neshatian M, Holcroft J, Ganss B", "date": "2018" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/31838295", "type": [ "PubMed" ], "id": "31838295" } ], "title": "DNA sequencing reveals AMELX, ODAM and MMP20 variations in dental fluorosis.", "journal": "Archives of oral biology", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ], "authors": "Tremillo-Maldonado O, Molina-Frechero N, Gonzalez-Gonzalez R, Damian-Matsumura P, Sanchez-Perez L, Sicco E, Suarez M, Bologna-Molina R", "date": "2020" } ], "uniprot_ac": "A1E959", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1E959#A1E959-1", "isoform_ac": "A1E959-1", "locus": { "end_pos": 70196544, "strand": "-", "start_pos": 70203182, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000396094", "id": "ENST00000396094", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000379401", "id": "ENSP00000379401", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A1E959-1|ODAM_HUMAN Isoform 1 of Odontogenic ameloblast-associated protein OS=Homo sapiens OX=9606 GN=ODAM PE=1 SV=1 CANONICAL=A1E959-1", "length": 279, "sequence": "MKIIILLGFLGATLSAPLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP" } }, { "url": "https://www.uniprot.org/uniprot/A1E959#D6RA81-1", "isoform_ac": "D6RA81-1", "locus": { "end_pos": 70196544, "strand": "-", "start_pos": 70202908, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000510709", "id": "ENST00000510709", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000423070", "id": "ENSP00000423070", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|D6RA81-1|ODAM_HUMAN Computationally mapped isoform of Odontogenic ameloblast-associated protein OS=Homo sapiens OX=9606 GN=ODAM PE=1 SV=2 CANONICAL=A1E959-1", "length": 253, "sequence": "MKIIILLGFLGATLSAPLLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELP" } }, { "url": "https://www.uniprot.org/uniprot/A1E959#H0Y8T7-1", "isoform_ac": "H0Y8T7-1", "locus": { "end_pos": 70198122, "strand": "-", "start_pos": 70200107, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000510847", "id": "ENST00000510847", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000422100", "id": "ENSP00000422100", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|H0Y8T7-1|ODAM_HUMAN Computationally mapped isoform of Odontogenic ameloblast-associated protein OS=Homo sapiens OX=9606 GN=ODAM PE=1 SV=1 CANONICAL=A1E959-1", "length": 30, "sequence": "QTPPQTQPGPSHVMPYVFSFKMPQEQGQNI" } }, { "url": "https://www.uniprot.org/uniprot/A1E959#H0YA46-1", "isoform_ac": "H0YA46-1", "locus": { "end_pos": 70197924, "strand": "-", "start_pos": 70203182, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000514097", "id": "ENST00000514097", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000426106", "id": "ENSP00000426106", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|H0YA46-1|ODAM_HUMAN Computationally mapped isoform of Odontogenic ameloblast-associated protein OS=Homo sapiens OX=9606 GN=ODAM PE=1 SV=1 CANONICAL=A1E959-1", "length": 216, "sequence": "GPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:54959", "resource": "KEGG Pathway", "id": "hsa:54959", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "resource": "Reactome", "id": "R-HSA-977225", "name": "Amyloid fiber formation" } ], "function": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "annotation": "AMELX and ODAM variations was not different between two populations of schoolchildren with respect to dental fluorosis (DF) severity; however, the presence of rs1784418 differed between phenotypes with regard to susceptibility to DF. Therefore, MMP20 might be related to the various phenotypes of DF", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "annotation": "Calcifying epithelial odontogenic tumor-associated amyloid consists of a unique and previously undescribed protein that we provisionally designate APin.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "annotation": "Data suggest that ODAM is a developmental antigen that has an essential role in tooth maturation and in the pathogenesis of certain odontogenic and other epithelial neoplasms", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "annotation": "Risk of recurrence correlated with cytoplasmic expression of ODAM and pAKT, whereas nuclear expression did not predict recurrence of gastrointestinal stromal tumors.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "annotation": "Similar to AMTN, ODAM is able to promote HA nucleation in a dose-dependent manner in SBF, and even outside of its biological context in vitro.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "annotation": "The inhibitory effects of ODAM on colorectal cancer cell growth were associated with PTEN elevation and PI3K/AKT signaling inactivation.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "annotation": "The protein sequences deduced from the cloned cDNA for rat, mouse, pig, and human were aligned together with those obtained from four other mammal genomes. Apin is highly conserved in mammals.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" } ] }, { "url": "https://www.uniprot.org/uniprot/A1E959#function", "annotation": "Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involved in the induction of RHOA activity via interaction with ARHGEF and expression of downstream factors such as ROCK. Plays a role in attachment of the junctional epithelium to the tooth surface.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959#function", "id": "A1E959", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "A1E960-1", "protein_name": "Odontogenic ameloblast-associated protein", "sequence": { "length": 273, "sequence": "MKIIILLGLIGASSSAPLISQRLLSASNSHELLLNLNNGQLLPLQFQGAFNSWIPPFPGFLQQQQAQVSGRPQFTLSTLESFAGLFPNQIPLSRQVGLAQGGQAGQPDLSQQQTPPQTQQSASPMSYVVPVKVPQDQTQMFQYYPVYMLLPWEQPQTVTSSPQHTGQQLFEEQIPFYNQFGFAPPQAEPGVPGGQQHLAFDSFVGTAPETPGMPVEGSLLYPQKEPISFKHDNAGVFMPTTSPKPSTDNFFTSGIDPTIAPEQKVKTDSLREP" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/49511", "id": "49511", "database": "MGI" }, { "url": "https://omabrowser.org/oma/group/A1E959/", "id": "A1E959", "database": "OMA" } ], "common_name": "Mouse", "organism": "Mus musculus", "gene_name": "Odam", "tax_id": 10090 }, { "uniprot_canonical_ac": "Q3HS83-1", "protein_name": "Odontogenic ameloblast-associated protein", "sequence": { "length": 278, "sequence": "MKIIILLGLIGATSSAPLITQRLLSASNSHELLLNLNNGQLLPLQFQSAFNSWIPPFPGLLQQQQQQAQVSGHPQFPLSTLESFAGLFPNQIPFSRQVGFAQGGQAGQPDFSQQQTPSQTQQASPMSYVVPVKVPQDQTQMFQYYPVYMLLPWEQPQQTVTSSPQQTGQQLYEEQIPFYNQFGFVPQQAEPGVPGGQQHLVLDSFVGTAPETPGMPAVEGPLYPQKEPIGFKQDNVGVSTPSTSPKPDTGNFFTSEINPTIAPLLPEQKVNADSLREP" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/49511", "id": "49511", "database": "MGI" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "gene_name": "Odam", "tax_id": 10116 } ], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "S", "start_pos": 249, "alt_nt": "A", "chr_id": "4", "ref_nt": "G", "chr_pos": "71068570", "disease": [ { "synonyms": [ { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "uterus neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1E959", "id": "A1E959", "database": "BioMuta" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "frequency": "0.2", "sequence_mut": "N", "subjects_tested": "558", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (STT->NTT); o-glyco-site-loss (S->N).", "end_pos": 249, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "G", "start_pos": 102, "alt_nt": "A", "chr_id": "4", "ref_nt": "G", "chr_pos": "71063804", "disease": [ { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1E959", "id": "A1E959", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "1.0", "sequence_mut": "E", "subjects_tested": "103", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.0%).", "end_pos": 102, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "T", "alt_nt": "null", "chr_id": "4", "ref_nt": "T", "chr_pos": "70202838C>", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757064634", "id": "rs757064634", "database": "dbSNP" }, { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757064634", "id": "rs757064634", "database": "ExAC" }, { "url": "http://gnomad.broadinstitute.org/awesome?query=rs757064634", "id": "rs757064634", "database": "gnomAD" } ], "glycoeffect": [ "o-glyco-site-loss" ], "sequence_mut": "I", "start_pos": 244, "keywords": [ "ebi", "germline" ], "end_pos": 244, "minor_allelic_frequency": "", "annotation": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I)." }, { "sequence_org": "D", "start_pos": 259, "alt_nt": "A", "chr_id": "4", "ref_nt": "G", "chr_pos": "71068599", "disease": [ { "synonyms": [ { "id": "DOID:4159", "url": "http://disease-ontology.org/term/DOID:4159", "resource": "Disease Ontology", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "url": "http://disease-ontology.org/term/DOID:4159", "resource": "Disease Ontology", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "url": "http://disease-ontology.org/term/DOID:4159", "resource": "Disease Ontology", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ], "recommended_name": { "id": "DOID:4159", "url": "http://disease-ontology.org/term/DOID:4159", "resource": "Disease Ontology", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1E959", "id": "A1E959", "database": "BioMuta" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "frequency": "0.1", "sequence_mut": "N", "subjects_tested": "820", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DQT->NQT).", "end_pos": 259, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "S", "start_pos": 25, "alt_nt": "A", "chr_id": "4", "ref_nt": "C", "chr_pos": "71062431", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1E959", "id": "A1E959", "database": "BioMuta" } ], "glycoeffect": [ "o-glyco-site-loss" ], "frequency": "2.0", "sequence_mut": "Y", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%).", "end_pos": 25, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "T", "alt_nt": "null", "chr_id": "4", "ref_nt": "A", "chr_pos": "70202895C>", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs927313202", "id": "rs927313202", "database": "dbSNP" }, { "url": "https://www.ncbi.nlm.nih.gov/snp/rs927313202#frequency_tab", "id": "rs927313202", "database": "TOPMed" }, { "url": "http://gnomad.broadinstitute.org/awesome?query=rs927313202", "id": "rs927313202", "database": "gnomAD" } ], "glycoeffect": [ "o-glyco-site-loss" ], "sequence_mut": "N", "start_pos": 263, "keywords": [ "ebi", "germline" ], "end_pos": 263, "minor_allelic_frequency": "", "annotation": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->N)." }, { "sequence_org": "N", "alt_nt": "null", "chr_id": "4", "ref_nt": "G", "chr_pos": "70197934A>", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760548673", "id": "rs760548673", "database": "dbSNP" }, { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760548673", "id": "rs760548673", "database": "ExAC" }, { "url": "https://www.ncbi.nlm.nih.gov/snp/rs760548673#frequency_tab", "id": "rs760548673", "database": "TOPMed" }, { "url": "http://gnomad.broadinstitute.org/awesome?query=rs760548673", "id": "rs760548673", "database": "gnomAD" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "sequence_mut": "S", "start_pos": 37, "keywords": [ "ebi", "germline" ], "end_pos": 37, "minor_allelic_frequency": "", "annotation": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLN->NLS)." }, { "sequence_org": "G", "start_pos": 39, "alt_nt": "A", "chr_id": "4", "ref_nt": "G", "chr_pos": "71063012", "disease": [ { "synonyms": [ { "id": "DOID:4159", "url": "http://disease-ontology.org/term/DOID:4159", "resource": "Disease Ontology", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "url": "http://disease-ontology.org/term/DOID:4159", "resource": "Disease Ontology", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "url": "http://disease-ontology.org/term/DOID:4159", "resource": "Disease Ontology", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ], "recommended_name": { "id": "DOID:4159", "url": "http://disease-ontology.org/term/DOID:4159", "resource": "Disease Ontology", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1E959", "id": "A1E959", "database": "BioMuta" }, { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556504909", "id": "rs556504909", "database": "dbSNP" }, { "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs556504909", "id": "rs556504909", "database": "1000Genomes" }, { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556504909", "id": "rs556504909", "database": "ExAC" }, { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs556504909", "id": "rs556504909", "database": "NCI-TCGA" }, { "url": "https://www.ncbi.nlm.nih.gov/snp/rs556504909#frequency_tab", "id": "rs556504909", "database": "TOPMed" }, { "url": "http://gnomad.broadinstitute.org/awesome?query=rs556504909", "id": "rs556504909", "database": "gnomAD" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "frequency": "0.2", "sequence_mut": "S", "subjects_tested": "820", "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ], "annotation": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NNG->NNS).", "end_pos": 39, "minor_allelic_frequency": "", "subjects_positive": "2" }, { "sequence_org": "I", "alt_nt": "null", "chr_id": "4", "ref_nt": "C", "chr_pos": "70198054T>", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1431482221", "id": "rs1431482221", "database": "dbSNP" }, { "url": "http://gnomad.broadinstitute.org/awesome?query=rs1431482221", "id": "rs1431482221", "database": "gnomAD" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "sequence_mut": "T", "start_pos": 91, "keywords": [ "ebi", "germline" ], "end_pos": 91, "minor_allelic_frequency": "", "annotation": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQI->NQT)." }, { "sequence_org": "F", "start_pos": 9, "alt_nt": "C", "chr_id": "4", "ref_nt": "T", "chr_pos": "71062285", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1E959", "id": "A1E959", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "2.0", "sequence_mut": "L", "subjects_tested": "50", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (2.0%).", "end_pos": 9, "minor_allelic_frequency": "", "subjects_positive": "1" } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "ac": "NP_060325.3", "name": "odontogenic ameloblast-associated protein isoform 1 precursor", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099512", "pmid": "14647039", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "supramolecular fiber", "id": "GO:0099512" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "pmid": "25911094", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "extracellular space", "id": "GO:0005615" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "pmid": "25911094", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "pmid": "25911094", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "cytoplasm", "id": "GO:0005737" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071944", "pmid": "25911094", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "cell periphery", "id": "GO:0071944" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "extracellular region", "id": "GO:0005576" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "nucleoplasm", "id": "GO:0005654" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "cytosol", "id": "GO:0005829" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072686", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "mitotic spindle", "id": "GO:0072686" } ], "total": 9, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934", "pmid": "25911094", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "positive regulation of protein phosphorylation", "id": "GO:0001934" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "pmid": "25911094", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "inflammatory response", "id": "GO:0006954" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "pmid": "25911094", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "positive regulation of gene expression", "id": "GO:0010628" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032956", "pmid": "25911094", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "regulation of actin cytoskeleton organization", "id": "GO:0032956" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043547", "pmid": "25911094", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "positive regulation of GTPase activity", "id": "GO:0043547" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042475", "pmid": "16674676", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "odontogenesis of dentin-containing tooth", "id": "GO:0042475" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060054", "pmid": "25911094", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "positive regulation of epithelial cell proliferation involved in wound healing", "id": "GO:0060054" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044267", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "cellular protein metabolic process", "id": "GO:0044267" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031214", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "name": "biomineral tissue development", "id": "GO:0031214" } ], "total": 9, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A1E959", "type": "synonym", "resource": "RefSeq", "name": "APIN" }, { "url": "https://www.uniprot.org/uniprot/A1E959", "type": "synonym", "resource": "UniProtKB", "name": "APIN" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1E959", "type": "synonym", "resource": "RefSeq", "name": "ODAM" }, { "url": "https://www.uniprot.org/uniprot/A1E959", "type": "recommended", "resource": "UniProtKB", "name": "ODAM" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1E959", "id": "A1E959", "database": "BioMuta" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ODAM", "id": "ODAM", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/54959", "id": "54959", "database": "GeneID" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=26043", "id": "26043", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A1E959*", "id": "A1E959", "database": "IntAct" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR026802", "id": "IPR026802", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:54959", "id": "hsa:54959", "database": "KEGG Pathway" }, { "url": "http://www.omim.org/entry/614843", "id": "614843", "database": "MIM" }, { "url": "https://www.nextprot.org/entry/NX_A1E959", "id": "NX_A1E959", "database": "neXtProt" }, { "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A1E959", "id": "A1E959", "database": "O-GlcNAc Database" }, { "url": "https://omabrowser.org/oma/group/NHVMPYV/", "id": "NHVMPYV", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1237925at2759", "id": "1237925at2759", "database": "OrthoDB" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16237", "id": "PTHR16237", "database": "PANTHER" }, { "url": "http://pfam.xfam.org/family/PF15424", "id": "PF15424", "database": "Pfam" }, { "url": "https://pharos.nih.gov/targets/A1E959", "id": "A1E959", "database": "PHAROS" }, { "url": "http://purl.obolibrary.org/obo/PR_PR_A1E959", "id": "PR_A1E959", "database": "PRO" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-977225", "id": "R-HSA-977225", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_060325.3", "id": "NP_060325.3", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A1E959", "id": "A1E959", "database": "UniProtKB" } ], "expression_disease": [ { "name": "Prostate cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "tumor of the prostate", "description": "" } ], "recommended_name": { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1E959", "id": "A1E959", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:10283", "significant": "Yes" }, { "name": "Urinary bladder cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1E959", "id": "A1E959", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:11054", "significant": "No" }, { "name": "Thyroid gland cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1E959", "id": "A1E959", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:1781", "significant": "No" }, { "name": "Liver cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "recommended_name": { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1E959", "id": "A1E959", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3571", "significant": "Yes" }, { "name": "Lung squamous cell carcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "Epidermoid cell carcinoma of the lung", "description": "" } ], "recommended_name": { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "lung squamous cell carcinoma", "description": "A non-small cell lung carcinoma that has_material_basis_in the squamous cell." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1E959", "id": "A1E959", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3907", "significant": "Yes" }, { "name": "Lung adenocarcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "bronchogenic lung adenocarcinoma", "description": "" }, { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "nonsmall cell adenocarcinoma", "description": "" } ], "recommended_name": { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "lung adenocarcinoma", "description": "A lung cancer that derives_from epithelial cells of glandular origin." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1E959", "id": "A1E959", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3910", "significant": "No" }, { "name": "Esophageal cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of the middle Third of the esophagus", "description": "" } ], "recommended_name": { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1E959", "id": "A1E959", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:5041", "significant": "Yes" } ], "glycosylation": [ { "residue": "Thr", "site_category": "predicted", "end_pos": 115, "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959#ptm_processing", "id": "A1E959", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 115, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "site_category": "predicted", "end_pos": 119, "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959#ptm_processing", "id": "A1E959", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 119, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "site_category": "predicted", "end_pos": 244, "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959#ptm_processing", "id": "A1E959", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 244, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Ser", "site_category": "predicted", "end_pos": 249, "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959#ptm_processing", "id": "A1E959", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 249, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "site_category": "predicted", "end_pos": 250, "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959#ptm_processing", "id": "A1E959", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 250, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "site_category": "predicted", "end_pos": 251, "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959#ptm_processing", "id": "A1E959", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 251, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "site_category": "predicted", "end_pos": 255, "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959#ptm_processing", "id": "A1E959", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 255, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Ser", "site_category": "predicted", "end_pos": 256, "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959#ptm_processing", "id": "A1E959", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 256, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "site_category": "predicted", "end_pos": 261, "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959#ptm_processing", "id": "A1E959", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 261, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "site_category": "predicted", "end_pos": 263, "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959#ptm_processing", "id": "A1E959", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 263, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Thr", "site_category": "predicted", "end_pos": 273, "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959#ptm_processing", "id": "A1E959", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 273, "glytoucan_ac": "", "type": "O-linked" }, { "residue": "Ser", "site_category": "predicted", "end_pos": 275, "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1E959#ptm_processing", "id": "A1E959", "database": "UniProtKB" } ], "subtype": "O-GalNAcylation", "relation": "attached", "start_pos": 275, "glytoucan_ac": "", "type": "O-linked" }, { "site_category": "reported_with_glycan", "evidence": [ { "url": "https://www.oglcnac.mcw.edu/search/?query_protein=A1E959", "id": "A1E959", "database": "O-GlcNAc Database" }, { "url": "https://www.ncbi.nlm.nih.gov/pubmed/28411811", "id": "28411811", "database": "PubMed" } ], "subtype": "O-GlcNAcylation", "relation": "attached", "glytoucan_ac": "G49108TO", "type": "O-linked" } ], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 30777.0, "chemical_mass": 30777.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000109205", "id": "ENSG00000109205", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1E959", "name": "ODAM", "locus": { "end_pos": 70204576, "strand": "+", "start_pos": 70196496, "chromosome": "4", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000109205", "id": "ENSG00000109205", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A1E959#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Apin" }, { "url": "https://www.uniprot.org/uniprot/A1E959#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "Odontogenic ameloblast-associated protein" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1E959", "type": "synonym", "resource": "RefSeq", "name": "odontogenic ameloblast-associated protein isoform 1 precursor" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1E959", "type": "synonym", "resource": "RefSeq", "name": "odontogenic, ameloblast asssociated; odontogenic ameloblast-associated protein" } ] }