{ "uniprot_canonical_ac": "A1A519-1", "ptm_annotation": [], "sequence": { "header": "sp|A1A519-1|F170A_HUMAN Isoform 1 of Protein FAM170A OS=Homo sapiens OX=9606 GN=FAM170A PE=2 SV=1 CANONICAL=A1A519-1", "length": 330, "sequence": "MKRRQKRKHLENEESQETAEKGGGMSKSQEDALQPGSTRVAKGWSQGVGEVTSTSEYCSCVSSSRKLIHSGIQRIHRDSPQPQSPLAQVQERGETPPRSQHVSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRVGTPPSDVSTRNLLSDSEPSGEEKEHEERTESDSLPGSPTVEDTPRAKTPDWLVTMENGFRCMACCRVFTTMEALQEHVQFGIREGFSCHVFHLTMAQLTGNMESESTQDEQEEENGNEKEEEEKPEAKEEEGQPTEEDLGLRRSWSQCPGCVFHSPKDRNS" }, "uniprot_id": "F170A_HUMAN", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Human", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A519", "id": "A1A519", "database": "UniProtKB" } ], "name": "Homo sapiens", "taxid": 9606 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/20162441", "type": [ "PubMed" ], "id": "20162441" } ], "title": "Isolation and characterization of a novel zinc finger gene, ZNFD, activating AP1(PMA) transcriptional activities.", "journal": "Mol. Cell. Biochem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A519", "id": "A1A519", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157463.1", "id": "NP_001157463.1", "database": "RefSeq" } ], "authors": "Li J., Liu J., Liu Y., Wang W., Wu S., Wang M., Liu Q., Lei C., Xu F.", "date": "2010" } ], "uniprot_ac": "A1A519", "site_annotation": [], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A1A519#A1A519-1", "isoform_ac": "A1A519-1", "locus": { "end_pos": 119629769, "strand": "-", "start_pos": 119635031, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000515256", "id": "ENST00000515256", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000422684", "id": "ENSP00000422684", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A1A519-1|F170A_HUMAN Isoform 1 of Protein FAM170A OS=Homo sapiens OX=9606 GN=FAM170A PE=2 SV=1 CANONICAL=A1A519-1", "length": 330, "sequence": "MKRRQKRKHLENEESQETAEKGGGMSKSQEDALQPGSTRVAKGWSQGVGEVTSTSEYCSCVSSSRKLIHSGIQRIHRDSPQPQSPLAQVQERGETPPRSQHVSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRVGTPPSDVSTRNLLSDSEPSGEEKEHEERTESDSLPGSPTVEDTPRAKTPDWLVTMENGFRCMACCRVFTTMEALQEHVQFGIREGFSCHVFHLTMAQLTGNMESESTQDEQEEENGNEKEEEEKPEAKEEEGQPTEEDLGLRRSWSQCPGCVFHSPKDRNS" } }, { "url": "https://www.uniprot.org/uniprot/A1A519#A1A519-2", "isoform_ac": "A1A519-2", "locus": { "end_pos": 119629769, "strand": "-", "start_pos": 119635031, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000335286", "id": "ENST00000335286", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000334285", "id": "ENSP00000334285", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A1A519-2|F170A_HUMAN Isoform 2 of Protein FAM170A OS=Homo sapiens OX=9606 GN=FAM170A PE=2 SV=1 CANONICAL=A1A519-1", "length": 329, "sequence": "MKRRQKRKHLENEESQETAEKGGGMSKSQEDALQPGSTRVAKGWSQGVGEVTSTSEYCSCVSSSRKLIHSGIQRIHRDSPQPQSPLAQVQERGETPPRSQHVSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRVGTPPSDVSTRNLLSDSEPSGEEKEHEERTESDSLPGSPTVEDTPRAKTPDWLVTMENGFRCMACCRVFTTMEALQEHVQFGIREGFSCHVFHLTMAQLTGNMESESTQDEQEEENGNEKEEEEKPEAKEEEGQPTEEDLGLRRSWSQCPGCVFHSPKDRN" } }, { "url": "https://www.uniprot.org/uniprot/A1A519#A1A519-3", "isoform_ac": "A1A519-3", "locus": { "end_pos": 119629769, "strand": "-", "start_pos": 119635031, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000379555", "id": "ENST00000379555", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000368873", "id": "ENSP00000368873", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A1A519-3|F170A_HUMAN Isoform 3 of Protein FAM170A OS=Homo sapiens OX=9606 GN=FAM170A PE=2 SV=1 CANONICAL=A1A519-1", "length": 282, "sequence": "MKRRQKRKHLENEESQETAEKGGGIQRIHRDSPQPQSPLAQVQERGETPPRSQHVSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRVGTPPSDVSTRNLLSDSEPSGEEKEHEERTESDSLPGSPTVEDTPRAKTPDWLVTMENGFRCMACCRVFTTMEALQEHVQFGIREGFSCHVFHLTMAQLTGNMESESTQDEQEEENGNEKEEEEKPEAKEEEGQPTEEDLGLRRSWSQCPGCVFHSPKDRN" } }, { "url": "https://www.uniprot.org/uniprot/A1A519#A1A519-4", "isoform_ac": "A1A519-4", "locus": {}, "sequence": { "header": "sp|A1A519-4|F170A_HUMAN Isoform 4 of Protein FAM170A OS=Homo sapiens OX=9606 GN=FAM170A PE=2 SV=1 CANONICAL=A1A519-1", "length": 244, "sequence": "MKRRQKRKHLENEESQETAEKGGGIQRIHRDSPQPQSPLAQVQERGETPPRSQHVSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRVGTPPSDVSTRNLLSDSEPSGEEKEHEERTESDSLPGSPTVEDTPRAKTPDWLVTMENGFRCMACCRVFTTMEALQEHVQFGIREGFSCPKMSRRRKMEMRRRRKRNQKQRRRRGSPQKKTLA" } }, { "url": "https://www.uniprot.org/uniprot/A1A519#A2VCN0-1", "isoform_ac": "A2VCN0-1", "locus": { "end_pos": 119629769, "strand": "-", "start_pos": 119635081, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000509264", "id": "ENST00000509264", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000423697", "id": "ENSP00000423697", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|A2VCN0-1|F170A_HUMAN Computationally mapped isoform of Protein FAM170A OS=Homo sapiens OX=9606 GN=FAM170A PE=2 SV=1 CANONICAL=A1A519-1", "length": 186, "sequence": "MKRRQKRKHLENEESQETAEKGGGMSKSQEDALQPGSTRVAKGWSQGVGEVTSTSEYCSCVSSSRKLIHSGIQRIHRDSPQPQSPLAQVQERGETPPRSQHVSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRQLRLMGQKILEDGVAFSC" } }, { "url": "https://www.uniprot.org/uniprot/A1A519#D6RIE9-1", "isoform_ac": "D6RIE9-1", "locus": { "end_pos": 119629769, "strand": "-", "start_pos": 119635031, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENST00000504819", "id": "ENST00000504819", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSP00000425939", "id": "ENSP00000425939", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "tr|D6RIE9-1|F170A_HUMAN Computationally mapped isoform of Protein FAM170A OS=Homo sapiens OX=9606 GN=FAM170A PE=2 SV=1 CANONICAL=A1A519-1", "length": 283, "sequence": "MKRRQKRKHLENEESQETAEKGGGIQRIHRDSPQPQSPLAQVQERGETPPRSQHVSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRVGTPPSDVSTRNLLSDSEPSGEEKEHEERTESDSLPGSPTVEDTPRAKTPDWLVTMENGFRCMACCRVFTTMEALQEHVQFGIREGFSCHVFHLTMAQLTGNMESESTQDEQEEENGNEKEEEEKPEAKEEEGQPTEEDLGLRRSWSQCPGCVFHSPKDRNS" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:340069", "resource": "KEGG Pathway", "id": "hsa:340069", "name": "" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A1A519#function", "annotation": "Acts as a nuclear transcription factor that positively regulates the expression of heat shock genes. Binds to heat shock promoter elements (HSE).", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A519#function", "id": "A1A519", "database": "UniProtKB" } ] }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157463.1", "annotation": "Data indicate that ZNFD is probably a new type of C(2)H(2) zinc finger protein that may activate AP1 transcriptional activities.", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157463.1", "id": "NP_001157463.1", "database": "RefSeq" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "F7EWY4-1", "protein_name": "Family with sequence similarity 170, member A", "sequence": { "length": 352, "sequence": "MKRRQKRKHLEIEESKEAGISKSQEDTSQPESTGAAKAQSPGVGEVSSASEYFSCVSSPHKFIHRSKGTRKLLQDSSKPRSPLDQVPEGEATIAPSQQASSSCPSYKTCVSSLCTNKEERGMKIYYMQVQMKKGVAVSWDTKETSESLEKQPRMEEATLPEGVWVGTPPSDVSTRNLLSDSEPIGEEKEHEEKPESDSPPGSPMVEERPRAKTPDWLVTMENGFRCMACCRVFPTMESLQEHVQYGIREGFSCHVFHLTMAQLVGHVESESAQEEEEEHQEAKEKPTEKKAEEQQPAEEDVGVKKPWSQCPGCVFDSPKDRRRRKDHRDNSGSRQNASSVKEDEKNNAPSNT" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A1A519/", "id": "A1A519", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/86702", "id": "86702", "database": "MGI" } ], "common_name": "Rat", "organism": "Rattus norvegicus", "gene_name": "Fam170a", "tax_id": 10116 }, { "uniprot_canonical_ac": "Q66LM6-1", "protein_name": "Protein FAM170A", "sequence": { "length": 333, "sequence": "MKRRQKRKHLEIEESKEAGISKSQEDISHPESTGVPKAQSPGVGEVSSASEYFSCVSSPQKLIHRSKGTWKLLQDSSKPRSPLDQVPEGEATTAPSQQASSSCPSYKTCVSSLCMNKEERGMKIYYMQVQMKKGVAISWDTKETSESLEKQPRMEEATLPEGVWVGTPPSDVSTRNLLSDSEPIGEEKEHEEKPESDSPPGSPAVEERPRAKTPDWLVTMENGFRCMACCRVFATMESLQEHVQYGIREGFSCHVFHLTMAQLIGSMESESTQEEEEDHTEETEKPKEEKAEEQQPTEEDVGMKKPWSQCPGCVFDSPKDRRRRKDHCDNSGS" }, "evidence": [ { "url": "https://omabrowser.org/oma/group/A1A519/", "id": "A1A519", "database": "OMA" }, { "url": "http://www.informatics.jax.org/homology/86702", "id": "86702", "database": "MGI" } ], "common_name": "Mouse", "organism": "Mus musculus", "gene_name": "Fam170a", "tax_id": 10090 } ], "interactions": [], "synthesized_glycans": [], "snv": [ { "sequence_org": "Q", "start_pos": 34, "alt_nt": "G", "chr_id": "5", "ref_nt": "A", "chr_pos": "118968473", "disease": [ { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1A519", "id": "A1A519", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "1.0", "sequence_mut": "R", "subjects_tested": "103", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.0%).", "end_pos": 34, "minor_allelic_frequency": "", "subjects_positive": "1" }, { "sequence_org": "R", "start_pos": 98, "alt_nt": "A", "chr_id": "5", "ref_nt": "G", "chr_pos": "118969736", "disease": [ { "synonyms": [ { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "tumor of the prostate", "description": "" } ], "recommended_name": { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." } }, { "synonyms": [], "recommended_name": { "id": "DOID:9256", "url": "http://disease-ontology.org/term/DOID:9256", "resource": "Disease Ontology", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." } }, { "synonyms": [ { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "uterus neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:363", "url": "http://disease-ontology.org/term/DOID:363", "resource": "Disease Ontology", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1A519", "id": "A1A519", "database": "BioMuta" } ], "glycoeffect": [], "frequency": "0.1", "sequence_mut": "H", "subjects_tested": "1118", "keywords": [ "biomuta", "somatic", "cancer", "disease" ], "annotation": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3). In dbSNP: rs748840322.", "end_pos": 98, "minor_allelic_frequency": "", "subjects_positive": "1" } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157463.1", "ac": "NP_001157463.1", "name": "protein FAM170A isoform 2", "summary": "" }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A519", "id": "A1A519", "database": "UniProtKB" } ], "name": "DNA binding", "id": "GO:0003677" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A519", "id": "A1A519", "database": "UniProtKB" } ], "name": "metal ion binding", "id": "GO:0046872" } ], "total": 2, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "pmid": "20162441", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A519", "id": "A1A519", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" } ], "total": 1, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "pmid": "20162441", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A519", "id": "A1A519", "database": "UniProtKB" } ], "name": "positive regulation of transcription, DNA-templated", "id": "GO:0045893" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006366", "pmid": "20162441", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A519", "id": "A1A519", "database": "UniProtKB" } ], "name": "transcription by RNA polymerase II", "id": "GO:0006366" } ], "total": 2, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A1A519", "type": "synonym", "resource": "RefSeq", "name": "FAM170A" }, { "url": "https://www.uniprot.org/uniprot/A1A519", "type": "recommended", "resource": "UniProtKB", "name": "FAM170A" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1A519", "type": "synonym", "resource": "RefSeq", "name": "ZNFD" }, { "url": "https://www.uniprot.org/uniprot/A1A519", "type": "synonym", "resource": "UniProtKB", "name": "ZNFD" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" }, { "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/A1A519", "id": "A1A519", "database": "BioMuta" }, { "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=FAM170A", "id": "FAM170A", "database": "GeneCards" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/340069", "id": "340069", "database": "GeneID" }, { "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=27963", "id": "27963", "database": "HGNC" }, { "url": "https://www.ebi.ac.uk/intact/interactors/id:A1A519*", "id": "A1A519", "database": "IntAct" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR033376", "id": "IPR033376", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR040879", "id": "IPR040879", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:340069", "id": "hsa:340069", "database": "KEGG Pathway" }, { "url": "http://www.omim.org/entry/618401", "id": "618401", "database": "MIM" }, { "url": "https://www.nextprot.org/entry/NX_A1A519", "id": "NX_A1A519", "database": "neXtProt" }, { "url": "https://omabrowser.org/oma/group/MEEMTLP/", "id": "MEEMTLP", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1142827at2759", "id": "1142827at2759", "database": "OrthoDB" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR33517", "id": "PTHR33517", "database": "PANTHER" }, { "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR33517:SF3", "id": "PTHR33517:SF3", "database": "PANTHER" }, { "url": "http://pfam.xfam.org/family/PF17734", "id": "PF17734", "database": "Pfam" }, { "url": "https://pharos.nih.gov/targets/A1A519", "id": "A1A519", "database": "PHAROS" }, { "url": "http://purl.obolibrary.org/obo/PR_PR_A1A519", "id": "PR_A1A519", "database": "PRO" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001157463.1", "id": "NP_001157463.1", "database": "RefSeq" }, { "url": "https://www.uniprot.org/uniprot/A1A519", "id": "A1A519", "database": "UniProtKB" } ], "expression_disease": [ { "name": "Prostate cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "tumor of the prostate", "description": "" } ], "recommended_name": { "id": "DOID:10283", "url": "http://disease-ontology.org/term/DOID:10283", "resource": "Disease Ontology", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A519", "id": "A1A519", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:10283", "significant": "No" }, { "name": "Urinary bladder cancer [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "tumor of the bladder", "description": "" } ], "recommended_name": { "id": "DOID:11054", "url": "http://disease-ontology.org/term/DOID:11054", "resource": "Disease Ontology", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A519", "id": "A1A519", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:11054", "significant": "No" }, { "name": "Thyroid gland cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid neoplasm", "description": "" } ], "recommended_name": { "id": "DOID:1781", "url": "http://disease-ontology.org/term/DOID:1781", "resource": "Disease Ontology", "name": "thyroid gland cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A519", "id": "A1A519", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:1781", "significant": "No" }, { "name": "Liver cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "primary malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "recommended_name": { "id": "DOID:3571", "url": "http://disease-ontology.org/term/DOID:3571", "resource": "Disease Ontology", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A519", "id": "A1A519", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3571", "significant": "No" }, { "name": "Lung squamous cell carcinoma [DO disease name]", "trend": "Down", "disease": [ { "synonyms": [ { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "Epidermoid cell carcinoma of the lung", "description": "" } ], "recommended_name": { "id": "DOID:3907", "url": "http://disease-ontology.org/term/DOID:3907", "resource": "Disease Ontology", "name": "lung squamous cell carcinoma", "description": "A non-small cell lung carcinoma that has_material_basis_in the squamous cell." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A519", "id": "A1A519", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3907", "significant": "No" }, { "name": "Lung adenocarcinoma [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "bronchogenic lung adenocarcinoma", "description": "" }, { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "nonsmall cell adenocarcinoma", "description": "" } ], "recommended_name": { "id": "DOID:3910", "url": "http://disease-ontology.org/term/DOID:3910", "resource": "Disease Ontology", "name": "lung adenocarcinoma", "description": "A lung cancer that derives_from epithelial cells of glandular origin." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A519", "id": "A1A519", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:3910", "significant": "No" }, { "name": "Esophageal cancer [DO disease name]", "trend": "Up", "disease": [ { "synonyms": [ { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "malignant tumor of the middle Third of the esophagus", "description": "" } ], "recommended_name": { "id": "DOID:5041", "url": "http://disease-ontology.org/term/DOID:5041", "resource": "Disease Ontology", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." } } ], "evidence": [ { "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/A1A519", "id": "A1A519", "database": "BioXpress" } ], "url": "http://disease-ontology.org/term/DOID:5041", "significant": "No" } ], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [ { "residue": "Thr", "kinase_gene_name": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A519", "id": "A1A519", "database": "UniProtKB" } ], "start_pos": "217", "end_pos": "217", "kinase_uniprot_canonical_ac": "" }, { "residue": "Ser", "kinase_gene_name": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A1A519", "id": "A1A519", "database": "UniProtKB" } ], "start_pos": "315", "end_pos": "315", "kinase_uniprot_canonical_ac": "" } ], "mass": { "monoisotopic_mass": 37158.0, "chemical_mass": 37158.0 }, "expression_tissue": [ { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000007", "uberon": "0000007", "name": "Pituitary gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000178", "uberon": "0000178", "name": "Blood" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000458", "uberon": "0000458", "name": "Endocervix" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000473", "uberon": "0000473", "name": "Testis" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000948", "uberon": "0000948", "name": "Heart" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000955", "uberon": "0000955", "name": "Brain" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000992", "uberon": "0000992", "name": "Ovary" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0000996", "uberon": "0000996", "name": "Vagina" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001043", "uberon": "0001043", "name": "Esophagus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001150", "uberon": "0001150", "name": "Body of pancreas" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001155", "uberon": "0001155", "name": "Colon" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001160", "uberon": "0001160", "name": "Fundus of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001161", "uberon": "0001161", "name": "Body of stomach" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001255", "uberon": "0001255", "name": "Urinary bladder" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0001987", "uberon": "0001987", "name": "Placenta" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002046", "uberon": "0002046", "name": "Thyroid gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002048", "uberon": "0002048", "name": "Lung" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002107", "uberon": "0002107", "name": "Liver" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002367", "uberon": "0002367", "name": "Prostate gland" }, "present": "yes", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0002369", "uberon": "0002369", "name": "Adrenal gland" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] }, { "tissue": { "url": "http://purl.obolibrary.org/obo/UBERON_0009853", "uberon": "0009853", "name": "Body of uterus" }, "present": "no", "evidence": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164334", "id": "ENSG00000164334", "database": "Bgee" } ] } ], "gene": [ { "url": "https://www.uniprot.org/uniprot/A1A519", "name": "FAM170A", "locus": { "end_pos": 119635822, "strand": "+", "start_pos": 119629559, "chromosome": "5", "evidence": [ { "url": "https://www.ensembl.org/id/ENSG00000164334", "id": "ENSG00000164334", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A1A519#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "Protein FAM170A" }, { "url": "https://www.uniprot.org/uniprot/A1A519#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Zinc finger domain-containing protein" }, { "url": "https://www.uniprot.org/uniprot/A1A519#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Zinc finger protein ZNFD" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1A519", "type": "synonym", "resource": "RefSeq", "name": "Znf domain containing protein; zinc finger protein ZNFD; zinc finger domain-containing protein; protein FAM170A" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A1A519", "type": "synonym", "resource": "RefSeq", "name": "protein FAM170A isoform 2" } ] }