{ "uniprot_canonical_ac": "A0JPK3-1", "ptm_annotation": [], "sequence": { "header": "sp|A0JPK3-1|ZFP57_RAT Isoform 1 of Zinc finger protein 57 OS=Rattus norvegicus OX=10116 GN=Zfp57 PE=2 SV=1 CANONICAL=A0JPK3-1", "length": 406, "sequence": "MAAKKQSKSAKALRTTVRYEDVAVSFTQEEWEYLTSTQKTLYQKVMSETFKNLTFVESKKKPQEPNPNLKDKDDDKSSTCTGVFKGGPFFFCLTCGKCFKKNTFLFNHQFPVRSRRLAVTKPQSRKALGHKPQHRGDRPFFCNLCGKTYRDASGLSRHRRAHVGYRPRSCPECGKCFRDQSEVNRHLKVHQNKKPVAGSHVKVHQNKPVASNQKQKGRVPPTTRESPAPALRHLKVIQGPVARAKARSSRASSLEVRSTSVTVARPREKVYCPYCRITFTMRTCLLNHLKIHFRRQPNQHFCCKESHSSNTLRMQKIYNCPVCDSSFRGKESLLNHLCSRRPIRLSKCWEILGHLLGYLREPLGNIFKVRESRKRRRKRISSDSSETEGPSGSDEVMEVDTDSDLS" }, "uniprot_id": "ZFP57_RAT", "enzyme_annotation": [], "glycation": [], "keywords": [], "species": [ { "common_name": "Rat", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "Rattus norvegicus", "taxid": 10116 } ], "publication": [ { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/15060004", "type": [ "PubMed" ], "id": "15060004" } ], "title": "The genomic sequence and comparative analysis of the rat major histocompatibility complex.", "journal": "Genome Res.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "authors": "Klages S., Lehrach H., Mueller I., Reinhardt R., Sudbrak R., Inoko H., Shiina T., Guenther E., Walter L., Himmelbauer H., Hurt P.", "date": "2004" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/15070898", "type": [ "PubMed" ], "id": "15070898" } ], "title": "Identification and characterization of ZFP-57, a novel zinc finger transcription factor in the mammalian peripheral nervous system.", "journal": "J. Biol. Chem.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_998730.2", "id": "NP_998730.2", "database": "RefSeq" } ], "authors": "Rahman M., Zoidl G., Harris B.S., Taveggia C., Wrabetz L., Bosse F., Mueller H.W., Dean C.H., Alonso M.B., Jessen K.R., Mirsky R., Parmantier E., Zoidl C.", "date": "2004" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/18622393", "type": [ "PubMed" ], "id": "18622393" } ], "title": "Hypomethylation of multiple imprinted loci in individuals with transient neonatal diabetes is associated with mutations in ZFP57.", "journal": "Nature genetics", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_998730.2", "id": "NP_998730.2", "database": "RefSeq" } ], "authors": "Mackay DJ, Callaway JL, Marks SM, White HE, Acerini CL, Boonen SE, Dayanikli P, Firth HV, Goodship JA, Haemers AP, Hahnemann JM, Kordonouri O, Masoud AF, Oestergaard E, Storr J, Ellard S, Hattersley AT, Robinson DO, Temple IK", "date": "2008" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/18854139", "type": [ "PubMed" ], "id": "18854139" } ], "title": "A maternal-zygotic effect gene, Zfp57, maintains both maternal and paternal imprints.", "journal": "Developmental cell", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_998730.2", "id": "NP_998730.2", "database": "RefSeq" } ], "authors": "Li X, Ito M, Zhou F, Youngson N, Zuo X, Leder P, Ferguson-Smith AC", "date": "2008" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/22495301", "type": [ "PubMed" ], "id": "22495301" } ], "title": "Hsp72 preserves muscle function and slows progression of severe muscular dystrophy.", "journal": "Nature", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_998730.2", "id": "NP_998730.2", "database": "RefSeq" } ], "authors": "Gehrig SM, van der Poel C, Sayer TA, Schertzer JD, Henstridge DC, Church JE, Lamon S, Russell AP, Davies KE, Febbraio MA, Lynch GS", "date": "2012" }, { "reference": [ { "url": "https://www.ncbi.nlm.nih.gov/pubmed/30602440", "type": [ "PubMed" ], "id": "30602440" } ], "title": "ZNF445 is a primary regulator of genomic imprinting.", "journal": "Genes & development", "evidence": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_998730.2", "id": "NP_998730.2", "database": "RefSeq" } ], "authors": "Takahashi N, Coluccio A, Thorball CW, Planet E, Shi H, Offner S, Turelli P, Imbeault M, Ferguson-Smith AC, Trono D", "date": "2019" } ], "uniprot_ac": "A0JPK3", "site_annotation": [ { "end_pos": 54, "annotation": "n_glycosylation_sequon", "start_pos": 52 } ], "isoforms": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3#A0JPK3-1", "isoform_ac": "A0JPK3-1", "locus": { "end_pos": 2014535, "strand": "+", "start_pos": 2018285, "chromosome": "20", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOT00000011704", "id": "ENSRNOT00000011704", "database": "Ensembl Transcript" }, { "url": "https://www.ensembl.org/id/ENSRNOP00000011704", "id": "ENSRNOP00000011704", "database": "Ensembl Peptide" } ] }, "sequence": { "header": "sp|A0JPK3-1|ZFP57_RAT Isoform 1 of Zinc finger protein 57 OS=Rattus norvegicus OX=10116 GN=Zfp57 PE=2 SV=1 CANONICAL=A0JPK3-1", "length": 406, "sequence": "MAAKKQSKSAKALRTTVRYEDVAVSFTQEEWEYLTSTQKTLYQKVMSETFKNLTFVESKKKPQEPNPNLKDKDDDKSSTCTGVFKGGPFFFCLTCGKCFKKNTFLFNHQFPVRSRRLAVTKPQSRKALGHKPQHRGDRPFFCNLCGKTYRDASGLSRHRRAHVGYRPRSCPECGKCFRDQSEVNRHLKVHQNKKPVAGSHVKVHQNKPVASNQKQKGRVPPTTRESPAPALRHLKVIQGPVARAKARSSRASSLEVRSTSVTVARPREKVYCPYCRITFTMRTCLLNHLKIHFRRQPNQHFCCKESHSSNTLRMQKIYNCPVCDSSFRGKESLLNHLCSRRPIRLSKCWEILGHLLGYLREPLGNIFKVRESRKRRRKRISSDSSETEGPSGSDEVMEVDTDSDLS" } } ], "pathway": [ { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:361783", "resource": "KEGG Pathway", "id": "rno:361783", "name": "" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-212436", "resource": "Reactome", "id": "R-RNO-212436", "name": "Generic Transcription Pathway" } ], "function": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3#function", "annotation": "Transcription regulator required to maintain maternal and paternal gene imprinting, a process by which gene expression is restricted in a parent of origin-specific manner by epigenetic modification of genomic DNA and chromatin, including DNA methylation. Acts by controlling DNA methylation during the earliest multicellular stages of development at multiple imprinting control regions (ICRs). Acts together with ZNF445. Required for the establishment of maternal methylation imprints at SNRPN locus. Acts as a transcriptional repressor in Schwann cells. Binds to a 5'-TGCCGC-3' consensus sequence and recognizes the methylated CpG within this element.", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3#function", "id": "A0JPK3", "database": "UniProtKB" } ] } ], "orthologs": [ { "uniprot_canonical_ac": "Q8C6P8-1", "protein_name": "Zinc finger protein 57", "sequence": { "length": 421, "sequence": "MAARKQSSQPSRTPVSYEDVAVSFTQEEWEYLTSTQKTLYQKVMSETFKNLTFVGSKKKPQEPSSDLQDKNEEQEKSSSCTGVFKGGPFFFCLTCGKCFKKNTFLFNHQFPVRSRRLAVTNPQSRKGKGYKAQHRGERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSEVNRHLKVHQNKPAASNQAGNQASNQRLKSRVPPTTPRSQAPALKYVKVIQGPVARAKARNSGASTLNVRSNSITVVRSREKISCPYCHITFTMRTCLLTHLKIHFRRQPNQHFCCKESAHSSNTLRMQKIYTCPVCDSSFRGKESLLDHLCCQRPIRFSKCWEILGHLLGYLHEPVVLGNIFKVRDSSGKRMESRRRRRKRACTENPETEGLSGKGRVAPWEMEGATSPESPVTEEDSD" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/7603", "id": "7603", "database": "MGI" } ], "common_name": "Mouse", "organism": "Mus musculus", "gene_name": "Zfp57", "tax_id": 10090 }, { "uniprot_canonical_ac": "Q9NU63-1", "protein_name": "Zinc finger protein 57 homolog", "sequence": { "length": 452, "sequence": "MAAGEPRSLLFFQKPVTFEDVAVNFTQEEWDCLDASQRVLYQDVMSETFKNLTSVARIFLHKPELITKLEQEEEQWRETRVLQASQAGPPFFCYTCGKCFSRRSYLYSHQFVHNPKLTNSCSQCGKLFRSPKSLSYHRRMHLGERPFCCTLCDKTYCDASGLSRHRRVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGTQAEFQTPIARSQRSIQGLLDVNHAPVARSQEPIFRTEGPMAQNQASVLKNQAPVTRTQAPITGTLCQDARSNSHPVKPSRLNVFCCPHCSLTFSKKSYLSRHQKAHLTEPPNYCFHCSKSFSSFSRLVRHQQTHWKQKSYLCPICDLSFGEKEGLMDHWRGYKGKDLCQSSHHKCRVILGQWLGFSHDVPTMAGEEWKHGGDQSPPRIHTPRRRGLREKACKGDKTKEAVSILKHK" }, "evidence": [ { "url": "http://www.informatics.jax.org/homology/7603", "id": "7603", "database": "MGI" } ], "common_name": "Human", "organism": "Homo sapiens", "gene_name": "ZFP57", "tax_id": 9606 } ], "interactions": [], "synthesized_glycans": [], "snv": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "refseq": { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_998730.2", "ac": "NP_998730.2", "name": "zinc finger protein 57", "summary": "has transcriptional repressor activity in Schwann cells; may play a role in early stages of Schwann cell development [RGD, Feb 2006]." }, "go_annotation": { "categories": [ { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "DNA binding", "id": "GO:0003677" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "chromatin binding", "id": "GO:0003682" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "metal ion binding", "id": "GO:0046872" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010385", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "double-stranded methylated DNA binding", "id": "GO:0010385" } ], "total": 6, "name": "Molecular Function" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "nucleus", "id": "GO:0005634" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005720", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "nuclear heterochromatin", "id": "GO:0005720" } ], "total": 2, "name": "Cellular Component" }, { "go_terms": [ { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "pmid": "21873635", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043045", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "DNA methylation involved in embryo development", "id": "GO:0043045" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010216", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "maintenance of DNA methylation", "id": "GO:0010216" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006349", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "regulation of gene expression by genetic imprinting", "id": "GO:0006349" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000653", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "regulation of genetic imprinting", "id": "GO:2000653" }, { "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071517", "pmid": "", "evidence": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "name": "maintenance of imprinting at mating-type locus", "id": "GO:0071517" } ], "total": 7, "name": "Biological Process" } ] }, "gene_names": [ { "url": "https://www.ncbi.nlm.nih.gov/protein/A0JPK3", "type": "synonym", "resource": "RefSeq", "name": "Zfp57" }, { "url": "https://www.uniprot.org/uniprot/A0JPK3", "type": "recommended", "resource": "UniProtKB", "name": "Zfp57" } ], "pro_annotation": [], "crossref": [ { "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000022730", "id": "ENSRNOG00000022730", "database": "Bgee" }, { "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07765", "id": "cd07765", "database": "CDD" }, { "url": "https://www.ncbi.nlm.nih.gov/gene/361783", "id": "361783", "database": "GeneID" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR001909", "id": "IPR001909", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "id": "IPR013087", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036051", "id": "IPR036051", "database": "InterPro" }, { "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "id": "IPR036236", "database": "InterPro" }, { "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:361783", "id": "rno:361783", "database": "KEGG Pathway" }, { "url": "https://omabrowser.org/oma/group/CGKLFWS/", "id": "CGKLFWS", "database": "OMA" }, { "url": "http://www.orthodb.org/?query=1318335at2759", "id": "1318335at2759", "database": "OrthoDB" }, { "url": "http://pfam.xfam.org/family/PF00096", "id": "PF00096", "database": "Pfam" }, { "url": "http://pfam.xfam.org/family/PF01352", "id": "PF01352", "database": "Pfam" }, { "url": "http://purl.obolibrary.org/obo/PR_PR_A0JPK3", "id": "PR_A0JPK3", "database": "PRO" }, { "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-212436", "id": "R-RNO-212436", "database": "Reactome" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/NP_998730.2", "id": "NP_998730.2", "database": "RefSeq" }, { "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1302981", "id": "1302981", "database": "RGD" }, { "url": "https://www.uniprot.org/uniprot/A0JPK3", "id": "A0JPK3", "database": "UniProtKB" } ], "expression_disease": [], "glycosylation": [], "mutagenesis": [], "disease": [], "phosphorylation": [], "mass": { "monoisotopic_mass": 46588.0, "chemical_mass": 46588.0 }, "expression_tissue": [], "gene": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3", "name": "Zfp57", "locus": { "end_pos": 2014170, "strand": "-", "start_pos": 2020537, "chromosome": "20", "evidence": [ { "url": "https://www.ensembl.org/id/ENSRNOG00000022730", "id": "ENSRNOG00000022730", "database": "Ensembl Gene" } ] } } ], "protein_names": [ { "url": "https://www.uniprot.org/uniprot/A0JPK3#names_and_taxonomy", "type": "synonym", "resource": "UniProtKB", "name": "Zfp-57" }, { "url": "https://www.uniprot.org/uniprot/A0JPK3#names_and_taxonomy", "type": "recommended", "resource": "UniProtKB", "name": "Zinc finger protein 57" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A0JPK3", "type": "synonym", "resource": "RefSeq", "name": "zfp-57" }, { "url": "https://www.ncbi.nlm.nih.gov/protein/A0JPK3", "type": "synonym", "resource": "RefSeq", "name": "zinc finger protein 57" } ] }